Puma concolor (puma): 112853187 Help Entry 112853187         CDS       T08890                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism pcoo  Puma concolor (puma) Pathway pcoo04066   HIF-1 signaling pathway pcoo04120   Ubiquitin mediated proteolysis pcoo05170   Human immunodeficiency virus 1 infection pcoo05200   Pathways in cancer pcoo05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pcoo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112853187 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     112853187 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112853187 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     112853187 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112853187 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcoo04121]     112853187 (ELOB)    03400 DNA repair and recombination proteins [BR:pcoo03400]     112853187 (ELOB) Ubiquitin system [BR:pcoo04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      112853187 (ELOB)    Cul5 complex      112853187 (ELOB) DNA repair and recombination proteins [BR:pcoo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      112853187 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  112853187 NCBI-ProteinID:  XP_025772497 UniProt:  A0A6P6H9W6 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MRGSWDGSRVPGAPGSFPHLAGIFVALDVAGTQVPGQHYVLRSGHTGAHVDDQLLDDGKT LGECGFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANEQA VQ NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgcgggggagctgggacgggagccgggttccaggggctccaggcagcttcccgcacctg gcaggcatctttgtggccctcgacgtagccggcacacaggttcccgggcagcactatgtg ctccgctctgggcacactggtgcccacgtggatgaccaacttctggatgatggcaagaca ctgggagagtgcggcttcaccagtcagacggcacggccgcaggccccagccaccgtgggg ctggccttccgggcagatgacgctttcgaggccctgcggatcgagcccttctccagtccg cccgagctgcccgatgtgatgaagccacaggactcaggaagcagcgccaatgaacaagca gtgcagtga

DBGET integrated database retrieval system