Puma concolor (puma): 112854194 Help Entry 112854194         CDS       T08890                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism pcoo  Puma concolor (puma) Pathway pcoo04081   Hormone signaling pcoo04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     112854194 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     112854194 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112854194 (GAST) Cytokines and neuropeptides [BR:pcoo04052]  Neuropeptides   GPCR binding    112854194 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  112854194 NCBI-ProteinID:  XP_025773443 UniProt:  A0A6P6HD44 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVCVLILALALTAFSEASWKPRSQLQDAPSGPGANRGLEPHWLNRLGPASHHRRQL GLQGPPQLVADLSKKQGPWLEEEEAAYGWMDFGRRSAEDGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcaacgactgtgtgtgtgcgtgctgatcttggcactggctctgaccgccttctctgaa gcttcctggaagccccgctcccagctgcaggatgcaccctcgggtccaggggccaacagg ggcctggaaccacattggctgaaccggctgggcccagcctctcaccaccgacggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggctg gaggaagaagaagcagcgtacggatggatggacttcggccgccgcagtgcagaggacggg gaccaacatccctag

DBGET integrated database retrieval system