Puma concolor (puma): 112855073 Help Entry 112855073         CDS       T08890                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism pcoo  Puma concolor (puma) Pathway pcoo04024   cAMP signaling pathway pcoo04062   Chemokine signaling pathway pcoo04064   NF-kappa B signaling pathway pcoo04210   Apoptosis pcoo04380   Osteoclast differentiation pcoo04620   Toll-like receptor signaling pathway pcoo04621   NOD-like receptor signaling pathway pcoo04622   RIG-I-like receptor signaling pathway pcoo04623   Cytosolic DNA-sensing pathway pcoo04625   C-type lectin receptor signaling pathway pcoo04657   IL-17 signaling pathway pcoo04658   Th1 and Th2 cell differentiation pcoo04659   Th17 cell differentiation pcoo04660   T cell receptor signaling pathway pcoo04662   B cell receptor signaling pathway pcoo04668   TNF signaling pathway pcoo04722   Neurotrophin signaling pathway pcoo04920   Adipocytokine signaling pathway pcoo04926   Relaxin signaling pathway pcoo04931   Insulin resistance pcoo04936   Alcoholic liver disease pcoo05132   Salmonella infection pcoo05134   Legionellosis pcoo05135   Yersinia infection pcoo05140   Leishmaniasis pcoo05142   Chagas disease pcoo05145   Toxoplasmosis pcoo05160   Hepatitis C pcoo05161   Hepatitis B pcoo05162   Measles pcoo05163   Human cytomegalovirus infection pcoo05164   Influenza A pcoo05166   Human T-cell leukemia virus 1 infection pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05168   Herpes simplex virus 1 infection pcoo05169   Epstein-Barr virus infection pcoo05170   Human immunodeficiency virus 1 infection pcoo05171   Coronavirus disease - COVID-19 pcoo05200   Pathways in cancer pcoo05203   Viral carcinogenesis pcoo05208   Chemical carcinogenesis - reactive oxygen species pcoo05215   Prostate cancer pcoo05220   Chronic myeloid leukemia pcoo05222   Small cell lung cancer pcoo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     112855073 (NFKBIA)    04668 TNF signaling pathway     112855073 (NFKBIA)    04024 cAMP signaling pathway     112855073 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112855073 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112855073 (NFKBIA)    04621 NOD-like receptor signaling pathway     112855073 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     112855073 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     112855073 (NFKBIA)    04625 C-type lectin receptor signaling pathway     112855073 (NFKBIA)    04660 T cell receptor signaling pathway     112855073 (NFKBIA)    04658 Th1 and Th2 cell differentiation     112855073 (NFKBIA)    04659 Th17 cell differentiation     112855073 (NFKBIA)    04657 IL-17 signaling pathway     112855073 (NFKBIA)    04662 B cell receptor signaling pathway     112855073 (NFKBIA)    04062 Chemokine signaling pathway     112855073 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     112855073 (NFKBIA)    04926 Relaxin signaling pathway     112855073 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     112855073 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     112855073 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112855073 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     112855073 (NFKBIA)    05203 Viral carcinogenesis     112855073 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112855073 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     112855073 (NFKBIA)    05215 Prostate cancer     112855073 (NFKBIA)    05222 Small cell lung cancer     112855073 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112855073 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     112855073 (NFKBIA)    05161 Hepatitis B     112855073 (NFKBIA)    05160 Hepatitis C     112855073 (NFKBIA)    05171 Coronavirus disease - COVID-19     112855073 (NFKBIA)    05164 Influenza A     112855073 (NFKBIA)    05162 Measles     112855073 (NFKBIA)    05168 Herpes simplex virus 1 infection     112855073 (NFKBIA)    05163 Human cytomegalovirus infection     112855073 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     112855073 (NFKBIA)    05169 Epstein-Barr virus infection     112855073 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     112855073 (NFKBIA)    05135 Yersinia infection     112855073 (NFKBIA)    05134 Legionellosis     112855073 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     112855073 (NFKBIA)    05140 Leishmaniasis     112855073 (NFKBIA)    05142 Chagas disease     112855073 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112855073 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112855073 (NFKBIA)    04931 Insulin resistance     112855073 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcoo03000]     112855073 (NFKBIA)    04131 Membrane trafficking [BR:pcoo04131]     112855073 (NFKBIA) Transcription factors [BR:pcoo03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     112855073 (NFKBIA) Membrane trafficking [BR:pcoo04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     112855073 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  112855073 NCBI-ProteinID:  XP_025774406 UniProt:  A0A6P6HGG5 LinkDB All DBs Position Unknown AA seq 253 aa AA seqDB search MHSAALGVFPSLTLRFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVIT NQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATNY NGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCGA DVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELP YDDCVLGGQRLTL NT seq 762 nt NT seq  +upstreamnt  +downstreamnt atgcactcagcggccctgggggtttttccctctcttacccttaggttcctgcacttggcc atcatccatgaagagaaggcattgaccatggaagtagtccgccaagtgaaaggagacctg gccttcctcaatttccagaacaacctgcagcagactccactccacttggctgtgatcacc aaccaaccagaaattgctgaggcacttctggaagctggctgtgatcctgagctccgagac tttcgaggaaatacccccctacacctcgcctgtgagcaaggctgcctggccagtgtggga gtcctgactcagacctgcaggacccagcacctctactccatcttgcaggccaccaactac aatggtcacacatgtctacacttagcctctatccatggctacctgggcatcgtggagctt ttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggccgaactgccctc caccttgcagtggacctgcagaattccgacctcgtgtcgcttttgttgaagtgtggggct gatgtcaacagagtcacctaccaaggctactccccgtaccagctcacctggggtcgtcca agtacacggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctgcca gagagcgaggatgaggagagctacgacacggagtcagagttcacagaggacgagctgccc tatgatgactgtgtgcttggaggccaacgcctgacgttatga

DBGET integrated database retrieval system