Puma concolor (puma): 112856087 Help Entry 112856087         CDS       T08890                                  Symbol CFL2 Name (RefSeq) cofilin-2   KO K05765   cofilin Organism pcoo  Puma concolor (puma) Pathway pcoo04360   Axon guidance pcoo04666   Fc gamma R-mediated phagocytosis pcoo04810   Regulation of actin cytoskeleton pcoo05133   Pertussis pcoo05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:pcoo00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112856087 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     112856087 (CFL2)   09158 Development and regeneration    04360 Axon guidance     112856087 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112856087 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     112856087 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112856087 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcoo04812]     112856087 (CFL2)    04147 Exosome [BR:pcoo04147]     112856087 (CFL2) Membrane trafficking [BR:pcoo04131]  Others   Actin-binding proteins    Others     112856087 (CFL2) Cytoskeleton proteins [BR:pcoo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      112856087 (CFL2) Exosome [BR:pcoo04147]  Exosomal proteins   Proteins found in most exosomes    112856087 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  112856087 NCBI-ProteinID:  XP_025775407 UniProt:  A0A6P6HI70 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPL NDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQV NGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtaagaaaatcttctacacaagaggagatcaaaaaaagaaagaaagccgttctc ttctgtttaagcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtg ggtgacattggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctg aatgattgccgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaa gacctagtatttatattctgggctcctgagagtgcacctttaaaaagcaagatgatttat gctagctctaaagatgccattaaaaagaaatttacaggtattaaacatgaatggcaagta aatggcttggatgatataaaggaccgttcaacacttggagagaaattgggaggcaacgta gtagtttcacttgaaggaaaacccttataa

DBGET integrated database retrieval system