Puma concolor (puma): 112856907 Help Entry 112856907         CDS       T08890                                  Symbol ARF1 Name (RefSeq) ADP-ribosylation factor 1   KO K07937   ADP-ribosylation factor 1/2 Organism pcoo  Puma concolor (puma) Pathway pcoo04072   Phospholipase D signaling pathway pcoo04144   Endocytosis pcoo05132   Salmonella infection pcoo05134   Legionellosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     112856907 (ARF1)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112856907 (ARF1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112856907 (ARF1)    05134 Legionellosis     112856907 (ARF1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112856907 (ARF1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112856907 (ARF1)    04031 GTP-binding proteins [BR:pcoo04031]     112856907 (ARF1) Membrane trafficking [BR:pcoo04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     112856907 (ARF1)   Arf GTPases and associated proteins    Arf GTPases     112856907 (ARF1)  Endosome - Golgi transport     112856907 (ARF1) Exosome [BR:pcoo04147]  Exosomal proteins   Proteins found in most exosomes    112856907 (ARF1) GTP-binding proteins [BR:pcoo04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     112856907 (ARF1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K FLAD1_M Motif Other DBs NCBI-GeneID:  112856907 NCBI-ProteinID:  XP_025775992 UniProt:  A0A6P6HJR1 LinkDB All DBs Position Unknown AA seq 181 aa AA seqDB search MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atgggaaatatcttcgcaaacctcttcaagggcctttttggcaaaaaagagatgcgcatt ctcatggtgggcctggatgctgcagggaagaccaccatcctgtacaaactgaagctgggt gagattgtgaccaccattcccaccataggctttaacgtggagacagtggagtacaagaac atcagcttcaccgtgtgggacgtgggcggccaggacaagatccggcccctgtggcgccac tacttccagaacacacaaggcctcatcttcgtggtggacagcaacgacagagagcgcgtg aacgaggcccgtgaggagctcatgaggatgctggcggaggacgagctcagggatgccgtc ctgctggtgttcgccaacaagcaggacctcccgaacgccatgaatgcagccgagatcacg gacaagctgggcctgcactcgctgcgccacaggaactggtacattcaggccacctgtgcc accagcggggacgggctctatgagggactggactggctgtccaatcagctccggaaccag aagtga

DBGET integrated database retrieval system