Puma concolor (puma): 112857196 Help Entry 112857196         CDS       T08890                                  Name (RefSeq) interferon beta-like   KO K05414   interferon alpha Organism pcoo  Puma concolor (puma) Pathway pcoo04060   Cytokine-cytokine receptor interaction pcoo04151   PI3K-Akt signaling pathway pcoo04217   Necroptosis pcoo04620   Toll-like receptor signaling pathway pcoo04621   NOD-like receptor signaling pathway pcoo04622   RIG-I-like receptor signaling pathway pcoo04623   Cytosolic DNA-sensing pathway pcoo04630   JAK-STAT signaling pathway pcoo04650   Natural killer cell mediated cytotoxicity pcoo04936   Alcoholic liver disease pcoo05152   Tuberculosis pcoo05160   Hepatitis C pcoo05161   Hepatitis B pcoo05162   Measles pcoo05163   Human cytomegalovirus infection pcoo05164   Influenza A pcoo05165   Human papillomavirus infection pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05168   Herpes simplex virus 1 infection pcoo05169   Epstein-Barr virus infection pcoo05170   Human immunodeficiency virus 1 infection pcoo05171   Coronavirus disease - COVID-19 pcoo05200   Pathways in cancer pcoo05320   Autoimmune thyroid disease pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112857196    04151 PI3K-Akt signaling pathway     112857196   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112857196  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112857196  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112857196    04621 NOD-like receptor signaling pathway     112857196    04622 RIG-I-like receptor signaling pathway     112857196    04623 Cytosolic DNA-sensing pathway     112857196    04650 Natural killer cell mediated cytotoxicity     112857196  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112857196   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112857196    05161 Hepatitis B     112857196    05160 Hepatitis C     112857196    05171 Coronavirus disease - COVID-19     112857196    05164 Influenza A     112857196    05162 Measles     112857196    05168 Herpes simplex virus 1 infection     112857196    05163 Human cytomegalovirus infection     112857196    05167 Kaposi sarcoma-associated herpesvirus infection     112857196    05169 Epstein-Barr virus infection     112857196    05165 Human papillomavirus infection     112857196   09171 Infectious disease: bacterial    05152 Tuberculosis     112857196   09163 Immune disease    05320 Autoimmune thyroid disease     112857196   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112857196   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112857196  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112857196 Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Interferons    112857196 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon MRB1590_C Motif Other DBs NCBI-GeneID:  112857196 NCBI-ProteinID:  XP_025776305 UniProt:  A0A6P6HKH0 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MTSRSLPSWALMLLLSSTACSLDCHFQRRGIWEIVQHLENLGGKFPLRCLKDRSNFRFLQ VAKIDQLPEETAFPAIGEMLRQVFNTFSLNVSQSLWNESRLERLLSGLYQQTEKTGICLE QDSGQEDHSSSQREGTRLAIKNYFQGIRDYLQGQKYSHCAWEVIRVEIRRCFLFIEQLTR RHRDQEIGHLHN NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgaccagccggagcttgccgagctgggctttgatgctacttctttccagtactgcctgc tctctggactgtcactttcaacggaggggcatctgggagattgtacaacatttagagaac cttggaggaaaatttcccctgagatgtctgaaggacagaagcaacttcagattcctccag gttgcaaaaatcgaccagcttccggaggaaactgctttcccggccattggagaaatgctg cgacaggtcttcaacactttcagcctgaatgtctcccaatcgttgtggaatgaaagccgt ttagagagactcctaagtggactgtatcagcaaacggagaagacagggatatgcctggag caggactctgggcaggaggatcattcatcctcgcaaagggagggtaccagacttgcaata aagaattatttccaaggcatccgtgactatttgcaaggccaaaagtatagccactgtgcc tgggaggtcatccgtgtggaaatccgaaggtgttttctcttcattgagcagctgacaaga agacatcgggaccaagaaataggtcatttacataactaa

DBGET integrated database retrieval system