Puma concolor (puma): 112857571 Help Entry 112857571         CDS       T08890                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism pcoo  Puma concolor (puma) Pathway pcoo04060   Cytokine-cytokine receptor interaction pcoo04061   Viral protein interaction with cytokine and cytokine receptor pcoo04062   Chemokine signaling pathway pcoo04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112857571 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     112857571 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112857571 (CCL22)    04062 Chemokine signaling pathway     112857571 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112857571 (CCL22) Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Chemokines    112857571 (CCL22) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Moricin Motif Other DBs NCBI-GeneID:  112857571 NCBI-ProteinID:  XP_025776697 UniProt:  A0A6P6HLR1 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MASLKILFLAVLVLLAMTLQATEAGPYGANVEDSVCCRDYFRHPLPSRMLKYFYWTSDSC RRPGVVFLTVRDREICADPRLPWVKKILQKMNP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagattctgttcctggctgtccttgtcctccttgctatgacacttcag gcaactgaggcaggcccctacggcgccaatgtggaagacagcgtctgctgccgagactac ttccgccaccccctgccttctcgcatgctgaagtatttctactggacttcagactcctgc cggaggcccggcgtggtcttccttacggtcagggaccgggagatctgtgctgaccccagg ctgccctgggtgaagaagattctgcagaagatgaacccatga

DBGET integrated database retrieval system