Puma concolor (puma): 112858002 Help Entry 112858002         CDS       T08890                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism pcoo  Puma concolor (puma) Pathway pcoo04060   Cytokine-cytokine receptor interaction pcoo04061   Viral protein interaction with cytokine and cytokine receptor pcoo04151   PI3K-Akt signaling pathway pcoo04625   C-type lectin receptor signaling pathway pcoo04630   JAK-STAT signaling pathway pcoo04658   Th1 and Th2 cell differentiation pcoo04659   Th17 cell differentiation pcoo04660   T cell receptor signaling pathway pcoo04672   Intestinal immune network for IgA production pcoo04940   Type I diabetes mellitus pcoo05135   Yersinia infection pcoo05142   Chagas disease pcoo05162   Measles pcoo05166   Human T-cell leukemia virus 1 infection pcoo05171   Coronavirus disease - COVID-19 pcoo05200   Pathways in cancer pcoo05320   Autoimmune thyroid disease pcoo05321   Inflammatory bowel disease pcoo05330   Allograft rejection pcoo05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112858002 (IL2)    04151 PI3K-Akt signaling pathway     112858002 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112858002 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     112858002 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112858002 (IL2)    04660 T cell receptor signaling pathway     112858002 (IL2)    04658 Th1 and Th2 cell differentiation     112858002 (IL2)    04659 Th17 cell differentiation     112858002 (IL2)    04672 Intestinal immune network for IgA production     112858002 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112858002 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112858002 (IL2)    05171 Coronavirus disease - COVID-19     112858002 (IL2)    05162 Measles     112858002 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     112858002 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     112858002 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     112858002 (IL2)    05321 Inflammatory bowel disease     112858002 (IL2)    05330 Allograft rejection     112858002 (IL2)    05332 Graft-versus-host disease     112858002 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112858002 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112858002 (IL2)    00536 Glycosaminoglycan binding proteins [BR:pcoo00536]     112858002 (IL2) Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Interleukins    112858002 (IL2) Glycosaminoglycan binding proteins [BR:pcoo00536]  Heparan sulfate / Heparin   Cytokines    112858002 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Leg1 Motif Other DBs NCBI-GeneID:  112858002 NCBI-ProteinID:  XP_025777097 UniProt:  A0A6P6HMX5 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS ETRFTCKYDDETATIVEFLNKWITFCQSIFSTLT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct gaaacaagattcacatgtaaatatgatgatgagacagcaaccattgtagaatttctgaac aaatggattaccttttgtcaaagcatcttctcaacgctgacttga

DBGET integrated database retrieval system