Puma concolor (puma): 112861515 Help Entry 112861515         CDS       T08890                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pcoo  Puma concolor (puma) Pathway pcoo04015   Rap1 signaling pathway pcoo04810   Regulation of actin cytoskeleton pcoo05014   Amyotrophic lateral sclerosis pcoo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     112861515 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     112861515 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112861515 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112861515 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112861515 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcoo04812]     112861515 (PFN3)    04147 Exosome [BR:pcoo04147]     112861515 (PFN3) Membrane trafficking [BR:pcoo04131]  Others   Actin-binding proteins    Others     112861515 (PFN3) Cytoskeleton proteins [BR:pcoo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      112861515 (PFN3) Exosome [BR:pcoo04147]  Exosomal proteins   Proteins found in most exosomes    112861515 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  112861515 NCBI-ProteinID:  XP_025780674 UniProt:  A0A6P6HYF0 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIMGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTVHELINGLRKQST NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaaaggctatatcagtgcagtgctgcgggaccagcgtattgatgacgtg gccatcatgggccactcagacaatcgctgcgtgtgggcatcgcgccctgggggccttcta gctgccatatcaccgcaggaggtgggtgtgctcacagggcctgatcggcacaccttcctg caggccggcctgagtgtggcaggccgccgctgctgcgtcatccgagaccacctgctgtct gagggagatggtgttctggacgctcgcactaaagggctggatgggcgtgctgtctgcgtg ggccacaccccgcgtgcgctcctggtgctcatgggccgacggggtgtgcatgggggcatc ctcaacaagacagtgcatgagctgatcaatgggctacgcaagcagagcacatag

DBGET integrated database retrieval system