Puma concolor (puma): 112861555 Help Entry 112861555         CDS       T08890                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism pcoo  Puma concolor (puma) Pathway pcoo04010   MAPK signaling pathway pcoo04020   Calcium signaling pathway pcoo04022   cGMP-PKG signaling pathway pcoo04114   Oocyte meiosis pcoo04218   Cellular senescence pcoo04310   Wnt signaling pathway pcoo04360   Axon guidance pcoo04370   VEGF signaling pathway pcoo04380   Osteoclast differentiation pcoo04625   C-type lectin receptor signaling pathway pcoo04650   Natural killer cell mediated cytotoxicity pcoo04658   Th1 and Th2 cell differentiation pcoo04659   Th17 cell differentiation pcoo04660   T cell receptor signaling pathway pcoo04662   B cell receptor signaling pathway pcoo04720   Long-term potentiation pcoo04724   Glutamatergic synapse pcoo04921   Oxytocin signaling pathway pcoo04922   Glucagon signaling pathway pcoo04924   Renin secretion pcoo05010   Alzheimer disease pcoo05014   Amyotrophic lateral sclerosis pcoo05020   Prion disease pcoo05022   Pathways of neurodegeneration - multiple diseases pcoo05031   Amphetamine addiction pcoo05152   Tuberculosis pcoo05163   Human cytomegalovirus infection pcoo05166   Human T-cell leukemia virus 1 infection pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05170   Human immunodeficiency virus 1 infection pcoo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112861555 (PPP3R2)    04310 Wnt signaling pathway     112861555 (PPP3R2)    04370 VEGF signaling pathway     112861555 (PPP3R2)    04020 Calcium signaling pathway     112861555 (PPP3R2)    04022 cGMP-PKG signaling pathway     112861555 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112861555 (PPP3R2)    04218 Cellular senescence     112861555 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112861555 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     112861555 (PPP3R2)    04660 T cell receptor signaling pathway     112861555 (PPP3R2)    04658 Th1 and Th2 cell differentiation     112861555 (PPP3R2)    04659 Th17 cell differentiation     112861555 (PPP3R2)    04662 B cell receptor signaling pathway     112861555 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     112861555 (PPP3R2)    04921 Oxytocin signaling pathway     112861555 (PPP3R2)    04924 Renin secretion     112861555 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     112861555 (PPP3R2)    04720 Long-term potentiation     112861555 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     112861555 (PPP3R2)    04380 Osteoclast differentiation     112861555 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112861555 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112861555 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     112861555 (PPP3R2)    05163 Human cytomegalovirus infection     112861555 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     112861555 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     112861555 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     112861555 (PPP3R2)    05014 Amyotrophic lateral sclerosis     112861555 (PPP3R2)    05020 Prion disease     112861555 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     112861555 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     112861555 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112861555 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcoo01009]     112861555 (PPP3R2) Protein phosphatases and associated proteins [BR:pcoo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112861555 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  112861555 NCBI-ProteinID:  XP_025780747 UniProt:  A0A6P6HYA1 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID VFDTDGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagctagttacccgacggagatgtgttcccacttcaaccacgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggactgttcgggctctctgagcgtg gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac gtcttcgacaccgacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctacgac atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg gacagggatggtgacgggagaatatccttcgaggaattcagtgcggtggtcggaaacctg gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system