Puma concolor (puma): 112863403 Help Entry 112863403         CDS       T08890                                  Symbol WNT7B Name (RefSeq) protein Wnt-7b   KO K00572   wingless-type MMTV integration site family, member 7 Organism pcoo  Puma concolor (puma) Pathway pcoo04150   mTOR signaling pathway pcoo04310   Wnt signaling pathway pcoo04390   Hippo signaling pathway pcoo04550   Signaling pathways regulating pluripotency of stem cells pcoo04916   Melanogenesis pcoo04934   Cushing syndrome pcoo05010   Alzheimer disease pcoo05022   Pathways of neurodegeneration - multiple diseases pcoo05165   Human papillomavirus infection pcoo05200   Pathways in cancer pcoo05205   Proteoglycans in cancer pcoo05217   Basal cell carcinoma pcoo05224   Breast cancer pcoo05225   Hepatocellular carcinoma pcoo05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     112863403 (WNT7B)    04390 Hippo signaling pathway     112863403 (WNT7B)    04150 mTOR signaling pathway     112863403 (WNT7B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     112863403 (WNT7B)  09150 Organismal Systems   09152 Endocrine system    04916 Melanogenesis     112863403 (WNT7B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112863403 (WNT7B)    05205 Proteoglycans in cancer     112863403 (WNT7B)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     112863403 (WNT7B)    05226 Gastric cancer     112863403 (WNT7B)    05217 Basal cell carcinoma     112863403 (WNT7B)    05224 Breast cancer     112863403 (WNT7B)   09172 Infectious disease: viral    05165 Human papillomavirus infection     112863403 (WNT7B)   09164 Neurodegenerative disease    05010 Alzheimer disease     112863403 (WNT7B)    05022 Pathways of neurodegeneration - multiple diseases     112863403 (WNT7B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     112863403 (WNT7B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    00536 Glycosaminoglycan binding proteins [BR:pcoo00536]     112863403 (WNT7B) Glycosaminoglycan binding proteins [BR:pcoo00536]  Heparan sulfate / Heparin   Morphogens    112863403 (WNT7B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  wnt DUF6973 EAGR_box Motif Other DBs NCBI-GeneID:  112863403 NCBI-ProteinID:  XP_025782297 UniProt:  A0A6P6I2N5 LinkDB All DBs Position Unknown AA seq 222 aa AA seqDB search MLLLSPRGALLSVYCPQIFLILSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP DAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA RRLMNLHNNEAGRKGLHPGHRGLRVSAGTGTDLPALCRGDHS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgctcctgctgtctccgcgcggcgcgctcctctccgtgtattgcccgcagatctttctg atcctgtccagcggcagctacctagcgctgtcgtccgtcgtggccctgggagccaacatc atctgcaacaagattcctggcttggccccacggcagcgtgccatctgccagagccggccc gatgccatcatcgtgatcggggagggggcgcagatgggcatcaacgagtgccagtaccaa ttccgcttcggacgctggaactgctccgccctgggcgagaagactgtcttcgggcaagag ctccgagtagggagccgggaggccgccttcacctacgccatcaccgcggccggggtggcc cacgcggtcacggccgcctgcagccaggggaacctgagcaactgcgggtgcgaccgagag aagcagggctactacaaccaggcggagggctggaagtggggcggctgctccgccgacgtg cgctacggcatcgacttctcccggcgcttcgtggacgcccgtgagatcaagaaaaacgca cggcgcctcatgaacctgcacaacaacgaggccggcaggaaggggctgcacccggggcac cggggcctgcgggtctctgcaggcacggggacagacttgcccgccctctgccgtggggac cacagctaa

DBGET integrated database retrieval system