Puma concolor (puma): 112867219 Help Entry 112867219         CDS       T08890                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism pcoo  Puma concolor (puma) Pathway pcoo04014   Ras signaling pathway pcoo04015   Rap1 signaling pathway pcoo04020   Calcium signaling pathway pcoo04022   cGMP-PKG signaling pathway pcoo04024   cAMP signaling pathway pcoo04070   Phosphatidylinositol signaling system pcoo04114   Oocyte meiosis pcoo04218   Cellular senescence pcoo04261   Adrenergic signaling in cardiomyocytes pcoo04270   Vascular smooth muscle contraction pcoo04371   Apelin signaling pathway pcoo04625   C-type lectin receptor signaling pathway pcoo04713   Circadian entrainment pcoo04720   Long-term potentiation pcoo04722   Neurotrophin signaling pathway pcoo04728   Dopaminergic synapse pcoo04740   Olfactory transduction pcoo04744   Phototransduction pcoo04750   Inflammatory mediator regulation of TRP channels pcoo04910   Insulin signaling pathway pcoo04912   GnRH signaling pathway pcoo04915   Estrogen signaling pathway pcoo04916   Melanogenesis pcoo04921   Oxytocin signaling pathway pcoo04922   Glucagon signaling pathway pcoo04924   Renin secretion pcoo04925   Aldosterone synthesis and secretion pcoo04970   Salivary secretion pcoo04971   Gastric acid secretion pcoo05010   Alzheimer disease pcoo05012   Parkinson disease pcoo05022   Pathways of neurodegeneration - multiple diseases pcoo05031   Amphetamine addiction pcoo05034   Alcoholism pcoo05133   Pertussis pcoo05152   Tuberculosis pcoo05163   Human cytomegalovirus infection pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05170   Human immunodeficiency virus 1 infection pcoo05200   Pathways in cancer pcoo05214   Glioma pcoo05417   Lipid and atherosclerosis pcoo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     112867219    04015 Rap1 signaling pathway     112867219    04371 Apelin signaling pathway     112867219    04020 Calcium signaling pathway     112867219    04070 Phosphatidylinositol signaling system     112867219    04024 cAMP signaling pathway     112867219    04022 cGMP-PKG signaling pathway     112867219  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     112867219    04218 Cellular senescence     112867219  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112867219   09152 Endocrine system    04910 Insulin signaling pathway     112867219    04922 Glucagon signaling pathway     112867219    04912 GnRH signaling pathway     112867219    04915 Estrogen signaling pathway     112867219    04921 Oxytocin signaling pathway     112867219    04916 Melanogenesis     112867219    04924 Renin secretion     112867219    04925 Aldosterone synthesis and secretion     112867219   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     112867219    04270 Vascular smooth muscle contraction     112867219   09154 Digestive system    04970 Salivary secretion     112867219    04971 Gastric acid secretion     112867219   09156 Nervous system    04728 Dopaminergic synapse     112867219    04720 Long-term potentiation     112867219    04722 Neurotrophin signaling pathway     112867219   09157 Sensory system    04744 Phototransduction     112867219    04740 Olfactory transduction     112867219    04750 Inflammatory mediator regulation of TRP channels     112867219   09159 Environmental adaptation    04713 Circadian entrainment     112867219  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112867219   09162 Cancer: specific types    05214 Glioma     112867219   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112867219    05163 Human cytomegalovirus infection     112867219    05167 Kaposi sarcoma-associated herpesvirus infection     112867219   09171 Infectious disease: bacterial    05133 Pertussis     112867219    05152 Tuberculosis     112867219   09164 Neurodegenerative disease    05010 Alzheimer disease     112867219    05012 Parkinson disease     112867219    05022 Pathways of neurodegeneration - multiple diseases     112867219   09165 Substance dependence    05031 Amphetamine addiction     112867219    05034 Alcoholism     112867219   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112867219    05418 Fluid shear stress and atherosclerosis     112867219  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcoo01009]     112867219   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcoo04131]     112867219    03036 Chromosome and associated proteins [BR:pcoo03036]     112867219   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112867219 Protein phosphatases and associated proteins [BR:pcoo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      112867219 Membrane trafficking [BR:pcoo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     112867219 Chromosome and associated proteins [BR:pcoo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      112867219 Exosome [BR:pcoo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    112867219 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 UPF0154 SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C Temptin_C EF-hand_EFHB_C EF-hand_11 EFhand_Ca_insen Caleosin DUF5580_M SurA_N_3 Motif Other DBs NCBI-GeneID:  112867219 NCBI-ProteinID:  XP_025785913 UniProt:  A0A6P6IG01 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLRGGDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacagaggaacaggtggccgagttcagggaggccttctgcctgttc gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg ggccagaaccccacggaggccgagctccgggacatggtgggtgagatcgaccgtgacggc aacggctccgtggacttccctgagttcctgggcatgatggcccggcagctgaggggcggg gacagcgaggagcagatccgggaggccttccgcgtgttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgacgac gaggtggacgagatgatccgggccgccgacgtggatggggacggccaggtcaactacgag gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system