Puma concolor (puma): 112869227 Help Entry 112869227         CDS       T08890                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism pcoo  Puma concolor (puma) Pathway pcoo03008   Ribosome biogenesis in eukaryotes pcoo03013   Nucleocytoplasmic transport pcoo03015   mRNA surveillance pathway pcoo05014   Amyotrophic lateral sclerosis pcoo05164   Influenza A Brite KEGG Orthology (KO) [BR:pcoo00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     112869227 (NXT1)    03015 mRNA surveillance pathway     112869227 (NXT1)    03008 Ribosome biogenesis in eukaryotes     112869227 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     112869227 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     112869227 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcoo03019]     112869227 (NXT1)    03009 Ribosome biogenesis [BR:pcoo03009]     112869227 (NXT1) Messenger RNA biogenesis [BR:pcoo03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      112869227 (NXT1) Ribosome biogenesis [BR:pcoo03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     112869227 (NXT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NTF2 Glyco_tran_10_N Cofilin_ADF Motif Other DBs NCBI-GeneID:  112869227 NCBI-ProteinID:  XP_025788105 UniProt:  A0A6P6IIR2 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAS NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcatcggtggacttcaagacctacgtggatcaggcctgcagagctgctgaggagttc gtcaacgtgtactataccaccatggataagcggcggcgcttgttgtcccgcctgtacatg ggcacagccaccctggtgtggaatggaaatgctgtttcaggacaagagtccttgagtgaa ttttttgaaatgttaccttctagtgagttccaaatcaacgtggtagactgccagcctgtc cacgatgaagccaccccgagccagactacagtcctcgttgtgatctgtgggacagtgaag tttgagggcaacaagcaacgggactttaaccagaacttcatcctgactgcccaggcctca cccagcaacacagtgtggaaaatagcaagtgactgcttccggttccaggactgggccagc tag

DBGET integrated database retrieval system