KEGG   Puma concolor (puma): 112870302
Entry
112870302         CDS       T08890                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pcoo  Puma concolor (puma)
Pathway
pcoo01521  EGFR tyrosine kinase inhibitor resistance
pcoo01522  Endocrine resistance
pcoo01524  Platinum drug resistance
pcoo04010  MAPK signaling pathway
pcoo04012  ErbB signaling pathway
pcoo04014  Ras signaling pathway
pcoo04015  Rap1 signaling pathway
pcoo04022  cGMP-PKG signaling pathway
pcoo04024  cAMP signaling pathway
pcoo04062  Chemokine signaling pathway
pcoo04066  HIF-1 signaling pathway
pcoo04068  FoxO signaling pathway
pcoo04071  Sphingolipid signaling pathway
pcoo04072  Phospholipase D signaling pathway
pcoo04114  Oocyte meiosis
pcoo04140  Autophagy - animal
pcoo04148  Efferocytosis
pcoo04150  mTOR signaling pathway
pcoo04151  PI3K-Akt signaling pathway
pcoo04210  Apoptosis
pcoo04218  Cellular senescence
pcoo04261  Adrenergic signaling in cardiomyocytes
pcoo04270  Vascular smooth muscle contraction
pcoo04350  TGF-beta signaling pathway
pcoo04360  Axon guidance
pcoo04370  VEGF signaling pathway
pcoo04371  Apelin signaling pathway
pcoo04380  Osteoclast differentiation
pcoo04510  Focal adhesion
pcoo04517  IgSF CAM signaling
pcoo04520  Adherens junction
pcoo04540  Gap junction
pcoo04550  Signaling pathways regulating pluripotency of stem cells
pcoo04611  Platelet activation
pcoo04613  Neutrophil extracellular trap formation
pcoo04620  Toll-like receptor signaling pathway
pcoo04621  NOD-like receptor signaling pathway
pcoo04625  C-type lectin receptor signaling pathway
pcoo04650  Natural killer cell mediated cytotoxicity
pcoo04657  IL-17 signaling pathway
pcoo04658  Th1 and Th2 cell differentiation
pcoo04659  Th17 cell differentiation
pcoo04660  T cell receptor signaling pathway
pcoo04662  B cell receptor signaling pathway
pcoo04664  Fc epsilon RI signaling pathway
pcoo04666  Fc gamma R-mediated phagocytosis
pcoo04668  TNF signaling pathway
pcoo04713  Circadian entrainment
pcoo04720  Long-term potentiation
pcoo04722  Neurotrophin signaling pathway
pcoo04723  Retrograde endocannabinoid signaling
pcoo04724  Glutamatergic synapse
pcoo04725  Cholinergic synapse
pcoo04726  Serotonergic synapse
pcoo04730  Long-term depression
pcoo04810  Regulation of actin cytoskeleton
pcoo04910  Insulin signaling pathway
pcoo04912  GnRH signaling pathway
pcoo04914  Progesterone-mediated oocyte maturation
pcoo04915  Estrogen signaling pathway
pcoo04916  Melanogenesis
pcoo04917  Prolactin signaling pathway
pcoo04919  Thyroid hormone signaling pathway
pcoo04921  Oxytocin signaling pathway
pcoo04926  Relaxin signaling pathway
pcoo04928  Parathyroid hormone synthesis, secretion and action
pcoo04929  GnRH secretion
pcoo04930  Type II diabetes mellitus
pcoo04933  AGE-RAGE signaling pathway in diabetic complications
pcoo04934  Cushing syndrome
pcoo04935  Growth hormone synthesis, secretion and action
pcoo04960  Aldosterone-regulated sodium reabsorption
pcoo05010  Alzheimer disease
pcoo05020  Prion disease
pcoo05022  Pathways of neurodegeneration - multiple diseases
pcoo05034  Alcoholism
pcoo05132  Salmonella infection
pcoo05133  Pertussis
pcoo05135  Yersinia infection
pcoo05140  Leishmaniasis
pcoo05142  Chagas disease
pcoo05145  Toxoplasmosis
pcoo05152  Tuberculosis
pcoo05160  Hepatitis C
pcoo05161  Hepatitis B
pcoo05163  Human cytomegalovirus infection
pcoo05164  Influenza A
pcoo05165  Human papillomavirus infection
pcoo05166  Human T-cell leukemia virus 1 infection
pcoo05167  Kaposi sarcoma-associated herpesvirus infection
pcoo05170  Human immunodeficiency virus 1 infection
pcoo05171  Coronavirus disease - COVID-19
pcoo05200  Pathways in cancer
pcoo05203  Viral carcinogenesis
pcoo05205  Proteoglycans in cancer
pcoo05206  MicroRNAs in cancer
pcoo05207  Chemical carcinogenesis - receptor activation
pcoo05208  Chemical carcinogenesis - reactive oxygen species
pcoo05210  Colorectal cancer
pcoo05211  Renal cell carcinoma
pcoo05212  Pancreatic cancer
pcoo05213  Endometrial cancer
pcoo05214  Glioma
pcoo05215  Prostate cancer
pcoo05216  Thyroid cancer
pcoo05218  Melanoma
pcoo05219  Bladder cancer
pcoo05220  Chronic myeloid leukemia
pcoo05221  Acute myeloid leukemia
pcoo05223  Non-small cell lung cancer
pcoo05224  Breast cancer
pcoo05225  Hepatocellular carcinoma
pcoo05226  Gastric cancer
pcoo05230  Central carbon metabolism in cancer
pcoo05231  Choline metabolism in cancer
pcoo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcoo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcoo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112870302 (MAPK1)
   04012 ErbB signaling pathway
    112870302 (MAPK1)
   04014 Ras signaling pathway
    112870302 (MAPK1)
   04015 Rap1 signaling pathway
    112870302 (MAPK1)
   04350 TGF-beta signaling pathway
    112870302 (MAPK1)
   04370 VEGF signaling pathway
    112870302 (MAPK1)
   04371 Apelin signaling pathway
    112870302 (MAPK1)
   04668 TNF signaling pathway
    112870302 (MAPK1)
   04066 HIF-1 signaling pathway
    112870302 (MAPK1)
   04068 FoxO signaling pathway
    112870302 (MAPK1)
   04072 Phospholipase D signaling pathway
    112870302 (MAPK1)
   04071 Sphingolipid signaling pathway
    112870302 (MAPK1)
   04024 cAMP signaling pathway
    112870302 (MAPK1)
   04022 cGMP-PKG signaling pathway
    112870302 (MAPK1)
   04151 PI3K-Akt signaling pathway
    112870302 (MAPK1)
   04150 mTOR signaling pathway
    112870302 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    112870302 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112870302 (MAPK1)
   04148 Efferocytosis
    112870302 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112870302 (MAPK1)
   04210 Apoptosis
    112870302 (MAPK1)
   04218 Cellular senescence
    112870302 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112870302 (MAPK1)
   04520 Adherens junction
    112870302 (MAPK1)
   04540 Gap junction
    112870302 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112870302 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112870302 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112870302 (MAPK1)
   04613 Neutrophil extracellular trap formation
    112870302 (MAPK1)
   04620 Toll-like receptor signaling pathway
    112870302 (MAPK1)
   04621 NOD-like receptor signaling pathway
    112870302 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    112870302 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    112870302 (MAPK1)
   04660 T cell receptor signaling pathway
    112870302 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    112870302 (MAPK1)
   04659 Th17 cell differentiation
    112870302 (MAPK1)
   04657 IL-17 signaling pathway
    112870302 (MAPK1)
   04662 B cell receptor signaling pathway
    112870302 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    112870302 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    112870302 (MAPK1)
   04062 Chemokine signaling pathway
    112870302 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112870302 (MAPK1)
   04929 GnRH secretion
    112870302 (MAPK1)
   04912 GnRH signaling pathway
    112870302 (MAPK1)
   04915 Estrogen signaling pathway
    112870302 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    112870302 (MAPK1)
   04917 Prolactin signaling pathway
    112870302 (MAPK1)
   04921 Oxytocin signaling pathway
    112870302 (MAPK1)
   04926 Relaxin signaling pathway
    112870302 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    112870302 (MAPK1)
   04919 Thyroid hormone signaling pathway
    112870302 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    112870302 (MAPK1)
   04916 Melanogenesis
    112870302 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112870302 (MAPK1)
   04270 Vascular smooth muscle contraction
    112870302 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112870302 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    112870302 (MAPK1)
   04725 Cholinergic synapse
    112870302 (MAPK1)
   04726 Serotonergic synapse
    112870302 (MAPK1)
   04720 Long-term potentiation
    112870302 (MAPK1)
   04730 Long-term depression
    112870302 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    112870302 (MAPK1)
   04722 Neurotrophin signaling pathway
    112870302 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    112870302 (MAPK1)
   04380 Osteoclast differentiation
    112870302 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112870302 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112870302 (MAPK1)
   05206 MicroRNAs in cancer
    112870302 (MAPK1)
   05205 Proteoglycans in cancer
    112870302 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    112870302 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    112870302 (MAPK1)
   05203 Viral carcinogenesis
    112870302 (MAPK1)
   05230 Central carbon metabolism in cancer
    112870302 (MAPK1)
   05231 Choline metabolism in cancer
    112870302 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112870302 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112870302 (MAPK1)
   05212 Pancreatic cancer
    112870302 (MAPK1)
   05225 Hepatocellular carcinoma
    112870302 (MAPK1)
   05226 Gastric cancer
    112870302 (MAPK1)
   05214 Glioma
    112870302 (MAPK1)
   05216 Thyroid cancer
    112870302 (MAPK1)
   05221 Acute myeloid leukemia
    112870302 (MAPK1)
   05220 Chronic myeloid leukemia
    112870302 (MAPK1)
   05218 Melanoma
    112870302 (MAPK1)
   05211 Renal cell carcinoma
    112870302 (MAPK1)
   05219 Bladder cancer
    112870302 (MAPK1)
   05215 Prostate cancer
    112870302 (MAPK1)
   05213 Endometrial cancer
    112870302 (MAPK1)
   05224 Breast cancer
    112870302 (MAPK1)
   05223 Non-small cell lung cancer
    112870302 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112870302 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    112870302 (MAPK1)
   05161 Hepatitis B
    112870302 (MAPK1)
   05160 Hepatitis C
    112870302 (MAPK1)
   05171 Coronavirus disease - COVID-19
    112870302 (MAPK1)
   05164 Influenza A
    112870302 (MAPK1)
   05163 Human cytomegalovirus infection
    112870302 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112870302 (MAPK1)
   05165 Human papillomavirus infection
    112870302 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112870302 (MAPK1)
   05135 Yersinia infection
    112870302 (MAPK1)
   05133 Pertussis
    112870302 (MAPK1)
   05152 Tuberculosis
    112870302 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112870302 (MAPK1)
   05140 Leishmaniasis
    112870302 (MAPK1)
   05142 Chagas disease
    112870302 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112870302 (MAPK1)
   05020 Prion disease
    112870302 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    112870302 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    112870302 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    112870302 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112870302 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112870302 (MAPK1)
   04934 Cushing syndrome
    112870302 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112870302 (MAPK1)
   01524 Platinum drug resistance
    112870302 (MAPK1)
   01522 Endocrine resistance
    112870302 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcoo01001]
    112870302 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcoo03036]
    112870302 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcoo04147]
    112870302 (MAPK1)
Enzymes [BR:pcoo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     112870302 (MAPK1)
Protein kinases [BR:pcoo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   112870302 (MAPK1)
Chromosome and associated proteins [BR:pcoo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     112870302 (MAPK1)
Exosome [BR:pcoo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112870302 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 112870302
NCBI-ProteinID: XP_025789232
UniProt: A0A6P6IM94
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtatatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattagagcgccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgactttggcttggcccgcgttgcagatccagaccatgatcac
acagggttcctgacggagtacgtagccacacgttggtaccgggctccagaaattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttcccggggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaattgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgattccaaagctctggatttactggacaaaatgttgacgttcaaccctcacaag
aggattgaagtagaacaggctctggcccatccatatctggagcagtattacgacccaagt
gatgagcccgtcgctgaggcaccgttcaagttcgacatggagctagacgacctgcccaag
gaaaagctcaaagagctcatcttcgaagagacggccaggttccagcccggatacaggtct
taa

DBGET integrated database retrieval system