Puma concolor (puma): 112870579 Help Entry 112870579         CDS       T08890                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pcoo  Puma concolor (puma) Pathway pcoo03010   Ribosome pcoo04120   Ubiquitin mediated proteolysis pcoo04137   Mitophagy - animal pcoo04140   Autophagy - animal pcoo05012   Parkinson disease pcoo05022   Pathways of neurodegeneration - multiple diseases pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05171   Coronavirus disease Brite KEGG Orthology (KO) [BR:pcoo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     112870579   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112870579  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112870579    04137 Mitophagy - animal     112870579  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     112870579    05167 Kaposi sarcoma-associated herpesvirus infection     112870579   09164 Neurodegenerative disease    05012 Parkinson disease     112870579    05022 Pathways of neurodegeneration - multiple diseases     112870579  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pcoo03011]     112870579    04121 Ubiquitin system [BR:pcoo04121]     112870579   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112870579 Ribosome [BR:pcoo03011]  Ribosomal proteins   Eukaryotes    Small subunit     112870579   Archaea     112870579 Ubiquitin system [BR:pcoo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    112870579 Exosome [BR:pcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112870579   Exosomal proteins of colorectal cancer cells    112870579 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_S27 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  112870579 NCBI-ProteinID:  XP_025789485 UniProt:  A0A6P6IMS0 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MKTHMRKIITLEVEPLDTIENVKAKIQDKKGTPPDQHRLIFSCKQLEDGHTLSDCSIQKE STLHLLLRLCGGAKKRKKREAWKSYTTPKKNNHKRKKVQLSVLKYHKVDENGQINHLHLE CLSDECGAGVFITSHFGIILVSVF NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgaaaacccatatgaggaagatcatcactctcgaggttgaacccttggatacaatagaa aatgtaaaggccaagattcaggataagaaaggaactcctcctgatcagcacagactgatc ttctcttgcaagcaactggaagatggacatactttatctgactgtagcattcaaaaggag tccactcttcatcttctgttgcgactttgtggtggtgctaagaaaaggaagaagagagaa gcctggaagtcttataccactcccaagaagaataaccataagagaaagaaggttcagctg tctgtcttgaaataccataaggtggatgagaatggccaaatcaatcaccttcatctggag tgcctttcagatgaatgtggtgctggagtttttattactagccactttggcattattttg gtaagtgttttctga

DBGET integrated database retrieval system