Puma concolor (puma): 112871554 Help Entry 112871554         CDS       T08890                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism pcoo  Puma concolor (puma) Pathway pcoo04145   Phagocytosis pcoo04814   Motor proteins pcoo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcoo00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     112871554 (DYNLT3)   09142 Cell motility    04814 Motor proteins     112871554 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     112871554 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcoo03037]     112871554 (DYNLT3)    04812 Cytoskeleton proteins [BR:pcoo04812]     112871554 (DYNLT3) Cilium and associated proteins [BR:pcoo03037]  Motile cilia and associated proteins   Dynein arm    112871554 (DYNLT3) Cytoskeleton proteins [BR:pcoo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112871554 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  112871554 NCBI-ProteinID:  XP_025790373 UniProt:  A0A6P6IU29 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCDEVGFNVDEAHNIVKECIDGVLGGEDYNQNNINQWTASIVEQSLTHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgacgaggttggcttcaatgttgatgaagctcacaat attgttaaagagtgtatagatggggtcttgggaggtgaagattataaccagaataacatc aaccaatggactgcaagcatcgtggaacagtccttaacacatttggttaagctgggaaaa gcttataaatatatcgtgacctgtgcggtggtccagaggagtgcatatggctttcacaca gccagttcatgtttttgggatactacatctgatggaacctgtactgtgagatgggagaac cgaaccatgaactgtattgtcaatgtttttgccattgctattgtcctgtga

DBGET integrated database retrieval system