Puma concolor (puma): 112872284 Help Entry 112872284         CDS       T08890                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism pcoo  Puma concolor (puma) Pathway pcoo04022   cGMP-PKG signaling pathway pcoo04081   Hormone signaling pcoo04270   Vascular smooth muscle contraction pcoo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     112872284 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     112872284 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     112872284 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112872284 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112872284 (NPPC) Cytokines and neuropeptides [BR:pcoo04052]  Neuropeptides   Unclassified    112872284 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  112872284 NCBI-ProteinID:  XP_025791193 UniProt:  A0A6P6IW72 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctccggccc tctgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccaggggaggagctg gccgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggtggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag tcgcgggcggcgtgggcccgccttctgcacgagcaccctaacgcgcgcaaatacaaggga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system