Puma concolor (puma): 11473386 Help Entry 11473386          CDS       T08890                                  Symbol ND4L, KEH31_p05 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism pcoo  Puma concolor (puma) Pathway pcoo00190   Oxidative phosphorylation pcoo01100   Metabolic pathways pcoo04714   Thermogenesis pcoo04723   Retrograde endocannabinoid signaling pcoo05010   Alzheimer disease pcoo05012   Parkinson disease pcoo05014   Amyotrophic lateral sclerosis pcoo05016   Huntington disease pcoo05020   Prion disease pcoo05022   Pathways of neurodegeneration - multiple diseases pcoo05208   Chemical carcinogenesis - reactive oxygen species pcoo05415   Diabetic cardiomyopathy Module pcoo_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pcoo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     11473386 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     11473386 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     11473386 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     11473386 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     11473386 (ND4L)    05012 Parkinson disease     11473386 (ND4L)    05014 Amyotrophic lateral sclerosis     11473386 (ND4L)    05016 Huntington disease     11473386 (ND4L)    05020 Prion disease     11473386 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     11473386 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     11473386 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pcoo03029]     11473386 (ND4L) Enzymes [BR:pcoo01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      11473386 (ND4L) Mitochondrial biogenesis [BR:pcoo03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     11473386 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  11473386 NCBI-ProteinID:  YP_004940596 UniProt:  Q3L6Z6 G9K398 LinkDB All DBs Position MT AA seq 98 aa AA seqDB search MSMVYINIFLAFTMSLMGLLMYRSHLMSSLLCLEGMMLSLFIMMAVAILNNHFTLASMTP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccatagtctacattaacatcttcctggccttcaccatgtcactcataggactatta atgtaccgatcccacctaatatcttctctcttatgtctagaaggcataatattatcccta tttattataatggccgtagcaattctaaacaatcactttacactagccagcataacccct attattctactagtatttgcagcctgcgaggcggcactaggcctatccctgctagtaata gtatcaaatacatatggtaccgactatgtacaaaacctaaacctcctacaatgctaa

DBGET integrated database retrieval system