KEGG   Propithecus coquereli (Coquerel's sifaka): 105810199
Entry
105810199         CDS       T08746                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pcoq  Propithecus coquereli (Coquerel's sifaka)
Pathway
pcoq01521  EGFR tyrosine kinase inhibitor resistance
pcoq01522  Endocrine resistance
pcoq01524  Platinum drug resistance
pcoq04010  MAPK signaling pathway
pcoq04012  ErbB signaling pathway
pcoq04014  Ras signaling pathway
pcoq04015  Rap1 signaling pathway
pcoq04022  cGMP-PKG signaling pathway
pcoq04024  cAMP signaling pathway
pcoq04062  Chemokine signaling pathway
pcoq04066  HIF-1 signaling pathway
pcoq04068  FoxO signaling pathway
pcoq04071  Sphingolipid signaling pathway
pcoq04072  Phospholipase D signaling pathway
pcoq04114  Oocyte meiosis
pcoq04140  Autophagy - animal
pcoq04148  Efferocytosis
pcoq04150  mTOR signaling pathway
pcoq04151  PI3K-Akt signaling pathway
pcoq04210  Apoptosis
pcoq04218  Cellular senescence
pcoq04261  Adrenergic signaling in cardiomyocytes
pcoq04270  Vascular smooth muscle contraction
pcoq04350  TGF-beta signaling pathway
pcoq04360  Axon guidance
pcoq04370  VEGF signaling pathway
pcoq04371  Apelin signaling pathway
pcoq04380  Osteoclast differentiation
pcoq04510  Focal adhesion
pcoq04520  Adherens junction
pcoq04540  Gap junction
pcoq04550  Signaling pathways regulating pluripotency of stem cells
pcoq04611  Platelet activation
pcoq04613  Neutrophil extracellular trap formation
pcoq04620  Toll-like receptor signaling pathway
pcoq04621  NOD-like receptor signaling pathway
pcoq04625  C-type lectin receptor signaling pathway
pcoq04650  Natural killer cell mediated cytotoxicity
pcoq04657  IL-17 signaling pathway
pcoq04658  Th1 and Th2 cell differentiation
pcoq04659  Th17 cell differentiation
pcoq04660  T cell receptor signaling pathway
pcoq04662  B cell receptor signaling pathway
pcoq04664  Fc epsilon RI signaling pathway
pcoq04666  Fc gamma R-mediated phagocytosis
pcoq04668  TNF signaling pathway
pcoq04713  Circadian entrainment
pcoq04720  Long-term potentiation
pcoq04722  Neurotrophin signaling pathway
pcoq04723  Retrograde endocannabinoid signaling
pcoq04724  Glutamatergic synapse
pcoq04725  Cholinergic synapse
pcoq04726  Serotonergic synapse
pcoq04730  Long-term depression
pcoq04810  Regulation of actin cytoskeleton
pcoq04910  Insulin signaling pathway
pcoq04912  GnRH signaling pathway
pcoq04914  Progesterone-mediated oocyte maturation
pcoq04915  Estrogen signaling pathway
pcoq04916  Melanogenesis
pcoq04917  Prolactin signaling pathway
pcoq04919  Thyroid hormone signaling pathway
pcoq04921  Oxytocin signaling pathway
pcoq04926  Relaxin signaling pathway
pcoq04928  Parathyroid hormone synthesis, secretion and action
pcoq04929  GnRH secretion
pcoq04930  Type II diabetes mellitus
pcoq04933  AGE-RAGE signaling pathway in diabetic complications
pcoq04934  Cushing syndrome
pcoq04935  Growth hormone synthesis, secretion and action
pcoq04960  Aldosterone-regulated sodium reabsorption
pcoq05010  Alzheimer disease
pcoq05020  Prion disease
pcoq05022  Pathways of neurodegeneration - multiple diseases
pcoq05034  Alcoholism
pcoq05132  Salmonella infection
pcoq05133  Pertussis
pcoq05135  Yersinia infection
pcoq05140  Leishmaniasis
pcoq05142  Chagas disease
pcoq05145  Toxoplasmosis
pcoq05152  Tuberculosis
pcoq05160  Hepatitis C
pcoq05161  Hepatitis B
pcoq05163  Human cytomegalovirus infection
pcoq05164  Influenza A
pcoq05165  Human papillomavirus infection
pcoq05166  Human T-cell leukemia virus 1 infection
pcoq05167  Kaposi sarcoma-associated herpesvirus infection
pcoq05170  Human immunodeficiency virus 1 infection
pcoq05171  Coronavirus disease - COVID-19
pcoq05200  Pathways in cancer
pcoq05203  Viral carcinogenesis
pcoq05205  Proteoglycans in cancer
pcoq05206  MicroRNAs in cancer
pcoq05207  Chemical carcinogenesis - receptor activation
pcoq05208  Chemical carcinogenesis - reactive oxygen species
pcoq05210  Colorectal cancer
pcoq05211  Renal cell carcinoma
pcoq05212  Pancreatic cancer
pcoq05213  Endometrial cancer
pcoq05214  Glioma
pcoq05215  Prostate cancer
pcoq05216  Thyroid cancer
pcoq05218  Melanoma
pcoq05219  Bladder cancer
pcoq05220  Chronic myeloid leukemia
pcoq05221  Acute myeloid leukemia
pcoq05223  Non-small cell lung cancer
pcoq05224  Breast cancer
pcoq05225  Hepatocellular carcinoma
pcoq05226  Gastric cancer
pcoq05230  Central carbon metabolism in cancer
pcoq05231  Choline metabolism in cancer
pcoq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcoq05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcoq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105810199 (MAPK1)
   04012 ErbB signaling pathway
    105810199 (MAPK1)
   04014 Ras signaling pathway
    105810199 (MAPK1)
   04015 Rap1 signaling pathway
    105810199 (MAPK1)
   04350 TGF-beta signaling pathway
    105810199 (MAPK1)
   04370 VEGF signaling pathway
    105810199 (MAPK1)
   04371 Apelin signaling pathway
    105810199 (MAPK1)
   04668 TNF signaling pathway
    105810199 (MAPK1)
   04066 HIF-1 signaling pathway
    105810199 (MAPK1)
   04068 FoxO signaling pathway
    105810199 (MAPK1)
   04072 Phospholipase D signaling pathway
    105810199 (MAPK1)
   04071 Sphingolipid signaling pathway
    105810199 (MAPK1)
   04024 cAMP signaling pathway
    105810199 (MAPK1)
   04022 cGMP-PKG signaling pathway
    105810199 (MAPK1)
   04151 PI3K-Akt signaling pathway
    105810199 (MAPK1)
   04150 mTOR signaling pathway
    105810199 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105810199 (MAPK1)
   04148 Efferocytosis
    105810199 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105810199 (MAPK1)
   04210 Apoptosis
    105810199 (MAPK1)
   04218 Cellular senescence
    105810199 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105810199 (MAPK1)
   04520 Adherens junction
    105810199 (MAPK1)
   04540 Gap junction
    105810199 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    105810199 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105810199 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    105810199 (MAPK1)
   04613 Neutrophil extracellular trap formation
    105810199 (MAPK1)
   04620 Toll-like receptor signaling pathway
    105810199 (MAPK1)
   04621 NOD-like receptor signaling pathway
    105810199 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    105810199 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    105810199 (MAPK1)
   04660 T cell receptor signaling pathway
    105810199 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    105810199 (MAPK1)
   04659 Th17 cell differentiation
    105810199 (MAPK1)
   04657 IL-17 signaling pathway
    105810199 (MAPK1)
   04662 B cell receptor signaling pathway
    105810199 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    105810199 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    105810199 (MAPK1)
   04062 Chemokine signaling pathway
    105810199 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105810199 (MAPK1)
   04929 GnRH secretion
    105810199 (MAPK1)
   04912 GnRH signaling pathway
    105810199 (MAPK1)
   04915 Estrogen signaling pathway
    105810199 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    105810199 (MAPK1)
   04917 Prolactin signaling pathway
    105810199 (MAPK1)
   04921 Oxytocin signaling pathway
    105810199 (MAPK1)
   04926 Relaxin signaling pathway
    105810199 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    105810199 (MAPK1)
   04919 Thyroid hormone signaling pathway
    105810199 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    105810199 (MAPK1)
   04916 Melanogenesis
    105810199 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105810199 (MAPK1)
   04270 Vascular smooth muscle contraction
    105810199 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    105810199 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    105810199 (MAPK1)
   04725 Cholinergic synapse
    105810199 (MAPK1)
   04726 Serotonergic synapse
    105810199 (MAPK1)
   04720 Long-term potentiation
    105810199 (MAPK1)
   04730 Long-term depression
    105810199 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    105810199 (MAPK1)
   04722 Neurotrophin signaling pathway
    105810199 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    105810199 (MAPK1)
   04380 Osteoclast differentiation
    105810199 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    105810199 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105810199 (MAPK1)
   05206 MicroRNAs in cancer
    105810199 (MAPK1)
   05205 Proteoglycans in cancer
    105810199 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    105810199 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    105810199 (MAPK1)
   05203 Viral carcinogenesis
    105810199 (MAPK1)
   05230 Central carbon metabolism in cancer
    105810199 (MAPK1)
   05231 Choline metabolism in cancer
    105810199 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105810199 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105810199 (MAPK1)
   05212 Pancreatic cancer
    105810199 (MAPK1)
   05225 Hepatocellular carcinoma
    105810199 (MAPK1)
   05226 Gastric cancer
    105810199 (MAPK1)
   05214 Glioma
    105810199 (MAPK1)
   05216 Thyroid cancer
    105810199 (MAPK1)
   05221 Acute myeloid leukemia
    105810199 (MAPK1)
   05220 Chronic myeloid leukemia
    105810199 (MAPK1)
   05218 Melanoma
    105810199 (MAPK1)
   05211 Renal cell carcinoma
    105810199 (MAPK1)
   05219 Bladder cancer
    105810199 (MAPK1)
   05215 Prostate cancer
    105810199 (MAPK1)
   05213 Endometrial cancer
    105810199 (MAPK1)
   05224 Breast cancer
    105810199 (MAPK1)
   05223 Non-small cell lung cancer
    105810199 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105810199 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    105810199 (MAPK1)
   05161 Hepatitis B
    105810199 (MAPK1)
   05160 Hepatitis C
    105810199 (MAPK1)
   05171 Coronavirus disease - COVID-19
    105810199 (MAPK1)
   05164 Influenza A
    105810199 (MAPK1)
   05163 Human cytomegalovirus infection
    105810199 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105810199 (MAPK1)
   05165 Human papillomavirus infection
    105810199 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105810199 (MAPK1)
   05135 Yersinia infection
    105810199 (MAPK1)
   05133 Pertussis
    105810199 (MAPK1)
   05152 Tuberculosis
    105810199 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    105810199 (MAPK1)
   05140 Leishmaniasis
    105810199 (MAPK1)
   05142 Chagas disease
    105810199 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105810199 (MAPK1)
   05020 Prion disease
    105810199 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    105810199 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    105810199 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105810199 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    105810199 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    105810199 (MAPK1)
   04934 Cushing syndrome
    105810199 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105810199 (MAPK1)
   01524 Platinum drug resistance
    105810199 (MAPK1)
   01522 Endocrine resistance
    105810199 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcoq01001]
    105810199 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcoq03036]
    105810199 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcoq04147]
    105810199 (MAPK1)
Enzymes [BR:pcoq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105810199 (MAPK1)
Protein kinases [BR:pcoq01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105810199 (MAPK1)
Chromosome and associated proteins [BR:pcoq03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105810199 (MAPK1)
Exosome [BR:pcoq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105810199 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 105810199
NCBI-ProteinID: XP_012499584
Ensembl: ENSPCOG00000027637
UniProt: A0A2K6GUF3
LinkDB
Position
Unknown
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggccccgagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgag
caccagacctactgccagagaacgctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgatattattcgagcgccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctttacaaactcttgaagacacaacac
ctcagcaacgaccacatctgctattttctttaccagatcctcagagggttaaaatacatc
cactcagccaacgttctgcaccgtgacctcaagccttccaacctgctgctcaataccacc
tgcgatcttaagatctgcgactttggcctggcccgtgttgcagatccggaccatgatcac
acagggttcctgacagagtatgtagccacacgttggtacagggctccggaaattatgttg
aattccaagggctataccaagtccatcgatatttggtctgtaggctgcattctggcagaa
atgctctccaacaggcccatctttccagggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaattgtataataaatttaaaagct
agaaactatttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgactccaaagctctggacttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtggaacaggctctagcccacccatatctggagcagtattatgatccaagt
gacgagcccattgctgaagcaccattcaagtttgacatggaattggatgacttgcctaag
gaaaagctcaaagagctcatttttgaagagactgctagattccagccaggatacagatct
taa

DBGET integrated database retrieval system