KEGG   Propithecus coquereli (Coquerel's sifaka): 105810591
Entry
105810591         CDS       T08746                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
pcoq  Propithecus coquereli (Coquerel's sifaka)
Pathway
pcoq01521  EGFR tyrosine kinase inhibitor resistance
pcoq01522  Endocrine resistance
pcoq04010  MAPK signaling pathway
pcoq04012  ErbB signaling pathway
pcoq04014  Ras signaling pathway
pcoq04015  Rap1 signaling pathway
pcoq04062  Chemokine signaling pathway
pcoq04068  FoxO signaling pathway
pcoq04071  Sphingolipid signaling pathway
pcoq04072  Phospholipase D signaling pathway
pcoq04137  Mitophagy - animal
pcoq04140  Autophagy - animal
pcoq04150  mTOR signaling pathway
pcoq04151  PI3K-Akt signaling pathway
pcoq04210  Apoptosis
pcoq04211  Longevity regulating pathway
pcoq04213  Longevity regulating pathway - multiple species
pcoq04218  Cellular senescence
pcoq04360  Axon guidance
pcoq04370  VEGF signaling pathway
pcoq04371  Apelin signaling pathway
pcoq04540  Gap junction
pcoq04550  Signaling pathways regulating pluripotency of stem cells
pcoq04625  C-type lectin receptor signaling pathway
pcoq04650  Natural killer cell mediated cytotoxicity
pcoq04660  T cell receptor signaling pathway
pcoq04662  B cell receptor signaling pathway
pcoq04664  Fc epsilon RI signaling pathway
pcoq04714  Thermogenesis
pcoq04720  Long-term potentiation
pcoq04722  Neurotrophin signaling pathway
pcoq04725  Cholinergic synapse
pcoq04726  Serotonergic synapse
pcoq04730  Long-term depression
pcoq04810  Regulation of actin cytoskeleton
pcoq04910  Insulin signaling pathway
pcoq04912  GnRH signaling pathway
pcoq04915  Estrogen signaling pathway
pcoq04916  Melanogenesis
pcoq04917  Prolactin signaling pathway
pcoq04919  Thyroid hormone signaling pathway
pcoq04921  Oxytocin signaling pathway
pcoq04926  Relaxin signaling pathway
pcoq04929  GnRH secretion
pcoq04933  AGE-RAGE signaling pathway in diabetic complications
pcoq04935  Growth hormone synthesis, secretion and action
pcoq05010  Alzheimer disease
pcoq05022  Pathways of neurodegeneration - multiple diseases
pcoq05034  Alcoholism
pcoq05160  Hepatitis C
pcoq05161  Hepatitis B
pcoq05163  Human cytomegalovirus infection
pcoq05165  Human papillomavirus infection
pcoq05166  Human T-cell leukemia virus 1 infection
pcoq05167  Kaposi sarcoma-associated herpesvirus infection
pcoq05170  Human immunodeficiency virus 1 infection
pcoq05200  Pathways in cancer
pcoq05203  Viral carcinogenesis
pcoq05205  Proteoglycans in cancer
pcoq05206  MicroRNAs in cancer
pcoq05207  Chemical carcinogenesis - receptor activation
pcoq05208  Chemical carcinogenesis - reactive oxygen species
pcoq05210  Colorectal cancer
pcoq05211  Renal cell carcinoma
pcoq05213  Endometrial cancer
pcoq05214  Glioma
pcoq05215  Prostate cancer
pcoq05216  Thyroid cancer
pcoq05218  Melanoma
pcoq05219  Bladder cancer
pcoq05220  Chronic myeloid leukemia
pcoq05221  Acute myeloid leukemia
pcoq05223  Non-small cell lung cancer
pcoq05224  Breast cancer
pcoq05225  Hepatocellular carcinoma
pcoq05226  Gastric cancer
pcoq05230  Central carbon metabolism in cancer
pcoq05231  Choline metabolism in cancer
pcoq05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcoq05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcoq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105810591 (NRAS)
   04012 ErbB signaling pathway
    105810591 (NRAS)
   04014 Ras signaling pathway
    105810591 (NRAS)
   04015 Rap1 signaling pathway
    105810591 (NRAS)
   04370 VEGF signaling pathway
    105810591 (NRAS)
   04371 Apelin signaling pathway
    105810591 (NRAS)
   04068 FoxO signaling pathway
    105810591 (NRAS)
   04072 Phospholipase D signaling pathway
    105810591 (NRAS)
   04071 Sphingolipid signaling pathway
    105810591 (NRAS)
   04151 PI3K-Akt signaling pathway
    105810591 (NRAS)
   04150 mTOR signaling pathway
    105810591 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105810591 (NRAS)
   04137 Mitophagy - animal
    105810591 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    105810591 (NRAS)
   04218 Cellular senescence
    105810591 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105810591 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    105810591 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105810591 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105810591 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    105810591 (NRAS)
   04660 T cell receptor signaling pathway
    105810591 (NRAS)
   04662 B cell receptor signaling pathway
    105810591 (NRAS)
   04664 Fc epsilon RI signaling pathway
    105810591 (NRAS)
   04062 Chemokine signaling pathway
    105810591 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105810591 (NRAS)
   04929 GnRH secretion
    105810591 (NRAS)
   04912 GnRH signaling pathway
    105810591 (NRAS)
   04915 Estrogen signaling pathway
    105810591 (NRAS)
   04917 Prolactin signaling pathway
    105810591 (NRAS)
   04921 Oxytocin signaling pathway
    105810591 (NRAS)
   04926 Relaxin signaling pathway
    105810591 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    105810591 (NRAS)
   04919 Thyroid hormone signaling pathway
    105810591 (NRAS)
   04916 Melanogenesis
    105810591 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    105810591 (NRAS)
   04726 Serotonergic synapse
    105810591 (NRAS)
   04720 Long-term potentiation
    105810591 (NRAS)
   04730 Long-term depression
    105810591 (NRAS)
   04722 Neurotrophin signaling pathway
    105810591 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    105810591 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    105810591 (NRAS)
   04213 Longevity regulating pathway - multiple species
    105810591 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    105810591 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105810591 (NRAS)
   05206 MicroRNAs in cancer
    105810591 (NRAS)
   05205 Proteoglycans in cancer
    105810591 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    105810591 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    105810591 (NRAS)
   05203 Viral carcinogenesis
    105810591 (NRAS)
   05230 Central carbon metabolism in cancer
    105810591 (NRAS)
   05231 Choline metabolism in cancer
    105810591 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    105810591 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    105810591 (NRAS)
   05225 Hepatocellular carcinoma
    105810591 (NRAS)
   05226 Gastric cancer
    105810591 (NRAS)
   05214 Glioma
    105810591 (NRAS)
   05216 Thyroid cancer
    105810591 (NRAS)
   05221 Acute myeloid leukemia
    105810591 (NRAS)
   05220 Chronic myeloid leukemia
    105810591 (NRAS)
   05218 Melanoma
    105810591 (NRAS)
   05211 Renal cell carcinoma
    105810591 (NRAS)
   05219 Bladder cancer
    105810591 (NRAS)
   05215 Prostate cancer
    105810591 (NRAS)
   05213 Endometrial cancer
    105810591 (NRAS)
   05224 Breast cancer
    105810591 (NRAS)
   05223 Non-small cell lung cancer
    105810591 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105810591 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    105810591 (NRAS)
   05161 Hepatitis B
    105810591 (NRAS)
   05160 Hepatitis C
    105810591 (NRAS)
   05163 Human cytomegalovirus infection
    105810591 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    105810591 (NRAS)
   05165 Human papillomavirus infection
    105810591 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105810591 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    105810591 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    105810591 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    105810591 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    105810591 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105810591 (NRAS)
   01522 Endocrine resistance
    105810591 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcoq04131]
    105810591 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcoq04147]
    105810591 (NRAS)
   04031 GTP-binding proteins [BR:pcoq04031]
    105810591 (NRAS)
Membrane trafficking [BR:pcoq04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    105810591 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    105810591 (NRAS)
Exosome [BR:pcoq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105810591 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   105810591 (NRAS)
  Exosomal proteins of breast cancer cells
   105810591 (NRAS)
  Exosomal proteins of colorectal cancer cells
   105810591 (NRAS)
GTP-binding proteins [BR:pcoq04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    105810591 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 105810591
NCBI-ProteinID: XP_012500071
Ensembl: ENSPCOG00000013517
UniProt: A0A2K6EU94
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcagatattaacctctacagggagcagatt
aagcgagtaaaagattcagatgatgtacctatggtactggtaggaaacaagtgtgattta
ccaacaaggacagttgacacaaaacaagcccacgagctggccaagagttatgggattcca
tttattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttgccatgtgtggtgatgtaa

DBGET integrated database retrieval system