Entry |
|
Symbol |
MAPK14
|
Name |
(RefSeq) mitogen-activated protein kinase 14
|
KO |
|
Organism |
pcoq Propithecus coquereli (Coquerel's sifaka)
|
Pathway |
pcoq04261 | Adrenergic signaling in cardiomyocytes |
pcoq04550 | Signaling pathways regulating pluripotency of stem cells |
pcoq04613 | Neutrophil extracellular trap formation |
pcoq04620 | Toll-like receptor signaling pathway |
pcoq04621 | NOD-like receptor signaling pathway |
pcoq04622 | RIG-I-like receptor signaling pathway |
pcoq04625 | C-type lectin receptor signaling pathway |
pcoq04670 | Leukocyte transendothelial migration |
pcoq04723 | Retrograde endocannabinoid signaling |
pcoq04750 | Inflammatory mediator regulation of TRP channels |
pcoq04914 | Progesterone-mediated oocyte maturation |
pcoq04933 | AGE-RAGE signaling pathway in diabetic complications |
pcoq04935 | Growth hormone synthesis, secretion and action |
pcoq05022 | Pathways of neurodegeneration - multiple diseases |
pcoq05167 | Kaposi sarcoma-associated herpesvirus infection |
pcoq05170 | Human immunodeficiency virus 1 infection |
pcoq05208 | Chemical carcinogenesis - reactive oxygen species |
pcoq05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
pcoq05418 | Fluid shear stress and atherosclerosis |
|
Brite |
KEGG Orthology (KO) [BR:pcoq00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
105812191 (MAPK14)
04015 Rap1 signaling pathway
105812191 (MAPK14)
04370 VEGF signaling pathway
105812191 (MAPK14)
04668 TNF signaling pathway
105812191 (MAPK14)
04068 FoxO signaling pathway
105812191 (MAPK14)
04071 Sphingolipid signaling pathway
105812191 (MAPK14)
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
105812191 (MAPK14)
09143 Cell growth and death
04114 Oocyte meiosis
105812191 (MAPK14)
04218 Cellular senescence
105812191 (MAPK14)
09144 Cellular community - eukaryotes
04550 Signaling pathways regulating pluripotency of stem cells
105812191 (MAPK14)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
105812191 (MAPK14)
04613 Neutrophil extracellular trap formation
105812191 (MAPK14)
04620 Toll-like receptor signaling pathway
105812191 (MAPK14)
04621 NOD-like receptor signaling pathway
105812191 (MAPK14)
04622 RIG-I-like receptor signaling pathway
105812191 (MAPK14)
04625 C-type lectin receptor signaling pathway
105812191 (MAPK14)
04660 T cell receptor signaling pathway
105812191 (MAPK14)
04658 Th1 and Th2 cell differentiation
105812191 (MAPK14)
04659 Th17 cell differentiation
105812191 (MAPK14)
04657 IL-17 signaling pathway
105812191 (MAPK14)
04664 Fc epsilon RI signaling pathway
105812191 (MAPK14)
04670 Leukocyte transendothelial migration
105812191 (MAPK14)
09152 Endocrine system
04912 GnRH signaling pathway
105812191 (MAPK14)
04914 Progesterone-mediated oocyte maturation
105812191 (MAPK14)
04917 Prolactin signaling pathway
105812191 (MAPK14)
04926 Relaxin signaling pathway
105812191 (MAPK14)
04935 Growth hormone synthesis, secretion and action
105812191 (MAPK14)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
105812191 (MAPK14)
09156 Nervous system
04728 Dopaminergic synapse
105812191 (MAPK14)
04723 Retrograde endocannabinoid signaling
105812191 (MAPK14)
04722 Neurotrophin signaling pathway
105812191 (MAPK14)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
105812191 (MAPK14)
09158 Development and regeneration
04380 Osteoclast differentiation
105812191 (MAPK14)
09159 Environmental adaptation
04714 Thermogenesis
105812191 (MAPK14)
09160 Human Diseases
09161 Cancer: overview
05205 Proteoglycans in cancer
105812191 (MAPK14)
05208 Chemical carcinogenesis - reactive oxygen species
105812191 (MAPK14)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
105812191 (MAPK14)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
105812191 (MAPK14)
05161 Hepatitis B
105812191 (MAPK14)
05171 Coronavirus disease - COVID-19
105812191 (MAPK14)
05163 Human cytomegalovirus infection
105812191 (MAPK14)
05167 Kaposi sarcoma-associated herpesvirus infection
105812191 (MAPK14)
05169 Epstein-Barr virus infection
105812191 (MAPK14)
09171 Infectious disease: bacterial
05132 Salmonella infection
105812191 (MAPK14)
05135 Yersinia infection
105812191 (MAPK14)
05133 Pertussis
105812191 (MAPK14)
05152 Tuberculosis
105812191 (MAPK14)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
105812191 (MAPK14)
05140 Leishmaniasis
105812191 (MAPK14)
05142 Chagas disease
105812191 (MAPK14)
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
105812191 (MAPK14)
05020 Prion disease
105812191 (MAPK14)
05022 Pathways of neurodegeneration - multiple diseases
105812191 (MAPK14)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
105812191 (MAPK14)
05418 Fluid shear stress and atherosclerosis
105812191 (MAPK14)
05415 Diabetic cardiomyopathy
105812191 (MAPK14)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
105812191 (MAPK14)
04932 Non-alcoholic fatty liver disease
105812191 (MAPK14)
04933 AGE-RAGE signaling pathway in diabetic complications
105812191 (MAPK14)
09176 Drug resistance: antineoplastic
01522 Endocrine resistance
105812191 (MAPK14)
09180 Brite Hierarchies
09181 Protein families: metabolism
01001 Protein kinases [BR:pcoq01001]
105812191 (MAPK14)
Enzymes [BR:pcoq01000]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.24 mitogen-activated protein kinase
105812191 (MAPK14)
Protein kinases [BR:pcoq01001]
Serine/threonine kinases: CMGC group
MAPK family [OT]
105812191 (MAPK14)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
317 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRCTYFYFSLILPVDIWSVGCIMAELLTGRTLF
PGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVD
LLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYD
EVISFVPPPLDQEEMES |
NT seq |
954 nt +upstreamnt +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtccccggtgggctccggcgcctatggctcggtgtgtgct
gcttttgacacaaaaactgggttacgtgtggcggtgaagaagctatccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacaggtgcacgtacttttatttctctttaattttgcca
gttgatatttggtcagtgggatgcataatggccgagctgttgactggaagaacattgttt
cctggtacagaccatattgatcagttgaagctcattttaagactcgttggaaccccaggg
gctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcagtctttgacc
cagatgccgaagatgaactttgcgaatgtatttattggtgccaatcctttggccgtcgac
ttgctggagaagatgcttgtgttggactcagataagagaattacagcagcccaagccctt
gcacacgcctactttgctcagtaccatgaccctgatgatgagccagtggccgacccttat
gatcagtcctttgaaagcagggaccttctcatagatgagtggaaaagcctgacctacgat
gaagtcatcagctttgtgccgccaccccttgaccaagaagagatggagtcctga |