Poriferisphaera corsica: KS4_18900 Help Entry KS4_18900         CDS       T06996                                  Name (GenBank) RNA polymerase Rpb6   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism pcor  Poriferisphaera corsica Pathway pcor03020   RNA polymerase Brite KEGG Orthology (KO) [BR:pcor00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     KS4_18900  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pcor03021]     KS4_18900    03400 DNA repair and recombination proteins [BR:pcor03400]     KS4_18900 Enzymes [BR:pcor01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      KS4_18900 Transcription machinery [BR:pcor03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      KS4_18900 DNA repair and recombination proteins [BR:pcor03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       KS4_18900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  QDU33832 UniProt:  A0A517YUJ1 LinkDB All DBs Position 2175630..2176001 Genome browser AA seq 123 aa AA seqDB search MIEALKDDKVINEMGGRFKFTALVQHRIRQLMDGARPLVDRKGRSDFEIAVQEIIEGKIT YQLEGAEEPVPGMADPNAVVAQPITNTEVASPSAEELTAGIEAIAEAAQAAEAEDANEPP VAE NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgattgaagctcttaaggacgacaaagtcatcaacgaaatgggtggccgcttcaaattt accgccctcgtccagcaccgtatccgtcaactgatggacggcgcacgccccctcgtcgat cgtaaaggccgtagtgacttcgagatagctgttcaagaaatcatcgaaggcaagatcact tatcagctcgaaggcgctgaagagcctgtcccaggcatggcggatccaaacgccgtcgta gcgcaaccaattaccaatactgaagttgcatccccatcggcagaagagctaacagccggt atcgaagcgattgccgaggctgcacaagctgccgaagccgaggacgctaacgagcctcca gtcgctgaataa

DBGET integrated database retrieval system