Poriferisphaera corsica: KS4_23860 Help Entry KS4_23860         CDS       T06996                                  Name (GenBank) hypothetical protein   KO K02777   sugar PTS system EIIA component [EC:2.7.1.-] Organism pcor  Poriferisphaera corsica Pathway pcor00010   Glycolysis / Gluconeogenesis pcor00500   Starch and sucrose metabolism pcor00520   Amino sugar and nucleotide sugar metabolism pcor01100   Metabolic pathways pcor02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:pcor00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     KS4_23860    00500 Starch and sucrose metabolism     KS4_23860   09107 Glycan biosynthesis and metabolism    00520 Amino sugar and nucleotide sugar metabolism     KS4_23860  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     KS4_23860  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcor02000]     KS4_23860 Transporters [BR:pcor02000]  Phosphotransferase system (PTS)   Enzyme II [TC:4.A]    Glucose-specific II component     KS4_23860    N-Acetylglucosamine-specific II component     KS4_23860    Maltose/glucose-specific II component     KS4_23860    Beta-glucoside (arbutin/salicin/cellobiose)-specific II component     KS4_23860    Trehalose-specific II component     KS4_23860    N-Acetylmuramic acid-specific II component     KS4_23860    Alpha-glucoside-specific II component     KS4_23860 SSDB OrthologParalogGFIT Other DBs NCBI-ProteinID:  QDU34318 UniProt:  A0A517YVQ6 LinkDB All DBs Position complement(2740168..2740473) Genome browser AA seq 101 aa AA seqDB search MERIAEATCEIVENDFGIKNPVIKKNIVYVDVTQIMGLSSQGIWAIEDFGGGYVKLGGMV FPLHLIPVNFYSKHNGLLSKDDNRVLISFIVQVLEGACNES NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggaacgaatcgcagaagcaacatgtgaaatcgtagagaatgattttggcattaaaaac ccagtgattaagaagaacattgtatatgttgacgtgacacaaatcatggggctttctagc caaggcatttgggcgattgaagattttggtggtggctatgtaaagctgggcggtatggtt ttcccacttcatttgattcctgtgaatttctacagcaaacacaacgggttgttgtctaag gacgataaccgcgtattaatcagcttcattgttcaggtacttgaaggagcttgcaatgag tcctaa

DBGET integrated database retrieval system