Poriferisphaera corsica: KS4_34910 Help Entry KS4_34910         CDS       T06996                                  Name (GenBank) Anti-sigma-28 factor, FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pcor  Poriferisphaera corsica Pathway pcor02020   Two-component system pcor02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pcor00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     KS4_34910  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     KS4_34910  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pcor02035]     KS4_34910 Bacterial motility proteins [BR:pcor02035]  Flagellar system   Flagellar assembly proteins    Others     KS4_34910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  QDU35410 UniProt:  A0A517YYV2 LinkDB All DBs Position 4025433..4025711 Genome browser AA seq 92 aa AA seqDB search MSDIAPISRTSAAAVQTRMSVPAAPTAVETSPHRKADSVEFSEAARYLAKIAELPDIRQD LVDRVKGEIAAGTYDSEDKVDSMLDSLAEDLL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgagtgatattgccccaatcagtcgcacatccgcggccgcggttcagacacgaatgagt gtgcctgctgcaccgacggcggttgagacgagcccacatcggaaagccgacagtgtggag ttctcagaggcggcgcgttatttggcaaagatcgctgaacttccggacattcgtcaggac ctggtcgatcgcgttaaaggcgagatcgcagcgggtacgtacgattcggaagacaaggtc gattcaatgctagattcgctcgcagaggatttgctctaa

DBGET integrated database retrieval system