Prevotella communis: L6468_10325 Help Entry L6468_10325       CDS       T09070                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pcou  Prevotella communis Pathway pcou00020   Citrate cycle (TCA cycle) pcou00720   Other carbon fixation pathways pcou01100   Metabolic pathways pcou01110   Biosynthesis of secondary metabolites pcou01120   Microbial metabolism in diverse environments pcou01200   Carbon metabolism pcou01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pcou00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L6468_10325   09102 Energy metabolism    00720 Other carbon fixation pathways     L6468_10325 Enzymes [BR:pcou01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L6468_10325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_2 Fer4_7 Fer4_9 Fer4_6 Fer4_10 LdpA_Fe-S-bd Fer4_4 Fer4_16 Fer4_17 Fer4_22 Fer4_15 Fer4_8 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  UKK61383 LinkDB All DBs Position complement(2468505..2468735) Genome browser AA seq 76 aa AA seqDB search MAKMKGAIEVNTERCKGCSLCVIACPQKVIALANKVNLHGYPYVEAVNEEACVGCASCGI VCPDGCITVYRKKVEE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatgaaaggcgctattgaggtgaataccgagaggtgtaagggatgcagtctc tgcgtcatcgcctgccctcagaaggttatcgccctggccaacaaagttaatctgcacggt tatccctatgtggaggctgtcaacgaggaagcctgtgtgggctgtgcttcgtgtggcatt gtctgcccagatggctgtatcaccgtgtatcgtaaaaaagtggaggaataa

DBGET integrated database retrieval system