Pyrus communis (pear): 137709685 Help Entry 137709685         CDS       T10779                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism pcox  Pyrus communis (pear) Pathway pcox03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:pcox00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     137709685  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pcox03400]     137709685 DNA repair and recombination proteins [BR:pcox03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      137709685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  137709685 NCBI-ProteinID:  XP_068304771 LinkDB All DBs Position 12:21285651..21287532 Genome browser AA seq 103 aa AA seqDB search MEEPTFEPDLIHAIFKILWSRRAIERQMIEGTDALDGETGAGTSKKNRPTSANGNALKLS CELLRNFTTEAVQRAATIAEAEGVSKIEPTHLERVLPQLLLDF NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggaggaacccacatttgagcctgatctaattcacgcgattttcaagatcctctggtcc agaagagctatcgagcgtcaaatgatcgaaggcaccgatgcgttggatggcgagaccgga gctggaacatcaaagaagaatcgccccacatcagccaatggaaatgccttaaaattgagc tgtgaacttctccggaattttaccacagaggctgtgcagcgtgctgctacaattgctgaa gcggagggcgtgagtaaaattgaaccaactcacttggagcgggttctcccacagttgctt ttggatttttga

DBGET integrated database retrieval system