Pyrus communis (pear): 137710784 Help Entry 137710784         CDS       T10779                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism pcox  Pyrus communis (pear) Pathway pcox03018   RNA degradation pcox03040   Spliceosome Brite KEGG Orthology (KO) [BR:pcox00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     137710784   09123 Folding, sorting and degradation    03018 RNA degradation     137710784  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcox03019]     137710784    03041 Spliceosome [BR:pcox03041]     137710784 Messenger RNA biogenesis [BR:pcox03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      137710784   mRNA degradation factors    5'-3' decay     Lsm complex      137710784 Spliceosome [BR:pcox03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     137710784 SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  137710784 NCBI-ProteinID:  XP_068306010 LinkDB All DBs Position 12:complement(26249524..26253293) Genome browser AA seq 98 aa AA seqDB search MSSGPGLESLVDQTISVITNDGRNIVGVLKGFDQSTNIILDESHERVFSTKEGVQQLVLG LYIIRGDNISIVGELDADLDSTVEWSKMRAYPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccagtggccctggtcttgagtcactcgttgatcaaacaatttcagttatcacaaat gatggacggaatattgtgggagtcttgaaaggttttgaccagtctactaatattattctt gatgaatctcatgaacgtgttttttctacaaaggagggtgttcagcaactcgtgttgggg ttgtatataatcagaggtgacaacataagcattgttggggaattagatgcagatcttgat tctactgttgagtggtcgaagatgagagcttatcccctcaagcctgtcatccactga

DBGET integrated database retrieval system