Pyrus communis (pear): 137711031 Help Entry 137711031         CDS       T10779                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pcox  Pyrus communis (pear) Pathway pcox04016   MAPK signaling pathway - plant pcox04070   Phosphatidylinositol signaling system pcox04075   Plant hormone signal transduction pcox04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     137711031    04070 Phosphatidylinositol signaling system     137711031    04075 Plant hormone signal transduction     137711031  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     137711031  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcox01009]     137711031   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcox04131]     137711031    03036 Chromosome and associated proteins [BR:pcox03036]     137711031   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcox04147]     137711031 Protein phosphatases and associated proteins [BR:pcox01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      137711031 Membrane trafficking [BR:pcox04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     137711031 Chromosome and associated proteins [BR:pcox03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      137711031 Exosome [BR:pcox04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    137711031 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 Temptin_C Caleosin DUF5580_M SPEF2_C EFhand_Ca_insen EF-hand_11 FCaBP_EF-hand MotA_activ MecA_N PA_Ig-like YtzH Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  137711031 NCBI-ProteinID:  XP_068306328 LinkDB All DBs Position 12:25753296..25755168 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFCLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ NGTIDFSEFLNLMARKMKDTDSDEELKEAFKVFDKDQNGFISAAELRHVMANLGEKLTDE EVNEMICEADEDGDGQVNYEEFVRMMLNK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagagcagctaacggaggagcagatcgccgagttcaaggaagctttttgcctcttt gacaaagatggcgatggttgcatcactaccaaagagttgggaactgtgatgagatctttg ggacagaatcccactgaggctgaattgcaggacatgattagtgaagttgatgctgatcag aatggcacaatcgatttctccgagtttctgaatttgatggcgaggaagatgaaggatact gattccgatgaggaactcaaagaagctttcaaggtctttgacaaggaccagaatggcttc atttctgctgctgagcttcgacatgtaatggcgaatctcggtgagaaactgacggatgaa gaagtgaatgaaatgatctgtgaagcggacgaagatggcgatggccaggtgaactatgag gagtttgtgaggatgatgcttaacaagtga

DBGET integrated database retrieval system