Pyrus communis (pear): 137711135 Help Entry 137711135         CDS       T10779                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagosome pcox04148   Efferocytosis pcox04517   IgSF CAM signaling pcox04518   Integrin signaling pcox04620   Toll-like receptor signaling pathway pcox05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137711135    04518 Integrin signaling     137711135  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     137711135    04148 Efferocytosis     137711135  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     137711135  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     137711135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcox04131]     137711135   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcox04147]     137711135    04031 GTP-binding proteins [BR:pcox04031]     137711135 Membrane trafficking [BR:pcox04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     137711135  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     137711135   Macropinocytosis    Ras GTPases     137711135  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     137711135 Exosome [BR:pcox04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137711135   Exosomal proteins of other body fluids (saliva and urine)    137711135   Exosomal proteins of colorectal cancer cells    137711135   Exosomal proteins of bladder cancer cells    137711135 GTP-binding proteins [BR:pcox04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     137711135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU B12-binding Motif Other DBs NCBI-GeneID:  137711135 NCBI-ProteinID:  XP_068306443 LinkDB All DBs Position 12:22376070..22378855 Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGT KLDLRQDKQYLADHPGLVPVTTAQGEELRKQIGAAFYIECSSKTQQNVKAVFDAAIRVVI KPPQKQKEKKKKQRRGCPVNMLCGRRLVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagcgcttcaaggttcattaagtgtgtgactgtgggagatggggctgtgggg aagacctgtatgctgatttgctacaccagcaacaagtttcccactgactatataccaact gtgtttgataacttcagtgcaaatgtggtggttgaaggcactactgtgaacttaggctta tgggacactgctgggcaagaggattacaatcggttgaggccattgagctacagaggggca gatgtctttgtcttagctttctcattagttagccgtgcgagctatgagaatgtattgaaa aagtggatccctgaactccagcattatgctcccggagtgccagtagtacttgccggcacc aaattagatcttcgacaggataagcagtatttggctgatcacccaggattggtacctgtg accactgcacagggtgaggagctgcgaaaacagattggtgctgctttttatatagaatgc agctcaaaaacccagcagaatgtgaaagcagtcttcgatgctgcgatcagggtggttatc aagccgccacagaagcagaaggaaaagaagaaaaagcaacgtcgaggatgcccagtcaac atgctttgcggccggaggctggtgtgtctcaagtga

DBGET integrated database retrieval system