Pyrus communis (pear): 137714525 Help Entry 137714525         CDS       T10779                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagocytosis pcox04517   IgSF CAM signaling pcox04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137714525  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137714525   09142 Cell motility    04814 Motor proteins     137714525  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcox03037]     137714525    04812 Cytoskeleton proteins [BR:pcox04812]     137714525 Cilium and associated proteins [BR:pcox03037]  Motile cilia and associated proteins   Dynein arm    137714525 Cytoskeleton proteins [BR:pcox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137714525 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF7181 Motif Other DBs NCBI-GeneID:  137714525 NCBI-ProteinID:  XP_068309822 LinkDB All DBs Position 14:19791234..19791960 Genome browser AA seq 96 aa AA seqDB search MLEGKAVIVETNMLQTMQQKALDLTSKALDLFHVIEATEIGRFIKKEFDRTYGPGCLAVL LFRGVAGPEAEAKQSCAAALEAIQVGSSYSLHHFVL NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgctagagggtaaagcagttatcgttgagactaacatgcttcaaaccatgcaacagaag gcacttgacttgacttccaaagcccttgatttatttcatgtcattgaagccactgagata ggccgcttcattaaaaaggagtttgacaggacatatggacctggatgccttgcagttttg ctattcaggggagttgcaggtccagaagctgaggcaaagcagtcgtgtgcagcggccttg gaggcaatacaagtaggaagttcttattctcttcatcactttgtgctttga

DBGET integrated database retrieval system