Pyrus communis (pear): 137722709 Help Entry 137722709         CDS       T10779                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism pcox  Pyrus communis (pear) Pathway pcox03018   RNA degradation pcox03040   Spliceosome Brite KEGG Orthology (KO) [BR:pcox00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     137722709   09123 Folding, sorting and degradation    03018 RNA degradation     137722709  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcox03019]     137722709    03041 Spliceosome [BR:pcox03041]     137722709 Messenger RNA biogenesis [BR:pcox03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      137722709   mRNA degradation factors    5'-3' decay     Lsm complex      137722709 Spliceosome [BR:pcox03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     137722709 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Motif Other DBs NCBI-GeneID:  137722709 NCBI-ProteinID:  XP_068317882 LinkDB All DBs Position 2:complement(12740944..12743230) Genome browser AA seq 88 aa AA seqDB search MAANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITPEG RRITKLDQILLNGNNIAILVPGGSPEAE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggccgccaacaatccttcgcagctactcccatcagagttgatcgaccggtgcataggc tcgaagatatgggtgataatgaagggagacaaggagctcgtagggactctgaggggtttc gatgtctacgtcaacatggtactcgaagacgtcaccgaatatgagattactcctgaagga agacgtataaccaagcttgatcagattttactcaacggaaacaatattgccattctggtc cctggcggctcacctgaagcggaatga

DBGET integrated database retrieval system