Pyrus communis (pear): 137723641 Help Entry 137723641         CDS       T10779                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagocytosis pcox04517   IgSF CAM signaling pcox04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137723641  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137723641   09142 Cell motility    04814 Motor proteins     137723641  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcox03037]     137723641    04812 Cytoskeleton proteins [BR:pcox04812]     137723641 Cilium and associated proteins [BR:pcox03037]  Motile cilia and associated proteins   Dynein arm    137723641 Cytoskeleton proteins [BR:pcox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137723641 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  137723641 NCBI-ProteinID:  XP_068318938 LinkDB All DBs Position 17:14268991..14271419 Genome browser AA seq 114 aa AA seqDB search MLEGKAEVRETDMPDDMQSHAMELAYKALDLHEVSDFRSVAHYIKQKFDEAYGTAWHCVV GKNFGSCITHLSGSFIFFHVETTEFLMFKDCKNSTESREEGIGVLQIESPESDA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgctggaaggaaaagctgaggtgcgggaaacagatatgccagatgacatgcagagccat gccatggagttggcttacaaggctcttgatctccatgaagtttctgatttccgatccgtt gctcactatatcaaacagaaatttgatgaagcatatggcactgcctggcactgtgtagtg ggcaaaaactttgggtcctgcatcacacatttgagtggaagtttcattttcttccatgtg gaaacgacggagttcctcatgttcaaggattgcaaaaactctactgaaagcagggaagaa ggtattggagtgttgcagattgaaagcccagaaagtgatgcataa

DBGET integrated database retrieval system