Pyrus communis (pear): 137724317 Help Entry 137724317         CDS       T10779                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism pcox  Pyrus communis (pear) Pathway pcox03018   RNA degradation pcox03040   Spliceosome Brite KEGG Orthology (KO) [BR:pcox00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     137724317   09123 Folding, sorting and degradation    03018 RNA degradation     137724317  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcox03019]     137724317    03041 Spliceosome [BR:pcox03041]     137724317 Messenger RNA biogenesis [BR:pcox03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      137724317   mRNA degradation factors    5'-3' decay     Lsm complex      137724317 Spliceosome [BR:pcox03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     137724317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  137724317 NCBI-ProteinID:  XP_068319161 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSSGPGLESLVDQTISVITNDGRNIVGVLKGFDQSTNIILDESHERVFSTKEGVQQLVLG LYIIRGDNISIVGELDADLDSTVEWSKMRAYPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtcgagtggccctggtcttgagtcactcgttgatcaaacaatttcagttatcacaaat gatggacggaatattgtgggagtcttgaaaggctttgaccagtctactaatatcattctc gatgaatctcatgaacgtgttttctctacaaaggagggtgttcagcaactcgtgttgggg ttatatataatcagaggtgacaacataagcattgttggggaattagatgcagatcttgat tctactgttgagtggtcgaagatgagagcttatcccctcaagcctgtcatccactga

DBGET integrated database retrieval system