Pyrus communis (pear): 137725167 Help Entry 137725167         CDS       T10779                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagosome pcox04148   Efferocytosis pcox04517   IgSF CAM signaling pcox04518   Integrin signaling pcox04620   Toll-like receptor signaling pathway pcox05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137725167    04518 Integrin signaling     137725167  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     137725167    04148 Efferocytosis     137725167  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     137725167  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     137725167  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcox04131]     137725167   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcox04147]     137725167    04031 GTP-binding proteins [BR:pcox04031]     137725167 Membrane trafficking [BR:pcox04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     137725167  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     137725167   Macropinocytosis    Ras GTPases     137725167  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     137725167 Exosome [BR:pcox04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137725167   Exosomal proteins of other body fluids (saliva and urine)    137725167   Exosomal proteins of colorectal cancer cells    137725167   Exosomal proteins of bladder cancer cells    137725167 GTP-binding proteins [BR:pcox04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     137725167 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  137725167 NCBI-ProteinID:  XP_068319859 LinkDB All DBs Position 2:complement(17269842..17273110) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcctccaggttcataaagtgtgtcacagttggggatggagctgtgggaaaaacc tgtatgctcatctcctacaccagcaacactttccccacggattatgtgccaactgtgttt gacaatttcagtgcaaatgttgttgtggatgggagcaccgttaatttggggttgtgggat actgctgggcaggaagattacaatagattaagaccgttgagctaccgtggggcagatgta ttcctacttgcattctctctcataagcaaggccagctatgaaaatgttgccaagaagtgg gttcctgagttgaggcattatgcacctggtgttccaattattcttgttggaactaagctc gatcttcgagatgacaagcagttctttgtagatcaccctggtgcagtgccaattaccaca gcgcagggagaggaactaaggaagctgattggggctccggtttacatagaatgcagttca aaaacacagcagaatgtgaaagcagtctttgatgcagccattaaagtggttctccagcca ccaaagcagaagaaaaagaagagaaaggcacagaaggcgtgctccatattgtga

DBGET integrated database retrieval system