Pyrus communis (pear): 137725167 Help Entry 137725167         CDS       T10779                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagosome pcox04148   Efferocytosis pcox04620   Toll-like receptor signaling pathway pcox05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pcox00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     137725167    04148 Efferocytosis     137725167  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     137725167  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     137725167  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcox04131]     137725167   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcox04147]     137725167    04031 GTP-binding proteins [BR:pcox04031]     137725167 Membrane trafficking [BR:pcox04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     137725167  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     137725167   Macropinocytosis    Ras GTPases     137725167  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     137725167 Exosome [BR:pcox04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    137725167   Exosomal proteins of other body fluids (saliva and urine)    137725167   Exosomal proteins of colorectal cancer cells    137725167   Exosomal proteins of bladder cancer cells    137725167 GTP-binding proteins [BR:pcox04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     137725167 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  137725167 NCBI-ProteinID:  XP_068319859 LinkDB All DBs Position 2:complement(17269842..17273110) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKAQKACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcctccaggttcataaagtgtgtcacagttggggatggagctgtgggaaaaacc tgtatgctcatctcctacaccagcaacactttccccacggattatgtgccaactgtgttt gacaatttcagtgcaaatgttgttgtggatgggagcaccgttaatttggggttgtgggat actgctgggcaggaagattacaatagattaagaccgttgagctaccgtggggcagatgta ttcctacttgcattctctctcataagcaaggccagctatgaaaatgttgccaagaagtgg gttcctgagttgaggcattatgcacctggtgttccaattattcttgttggaactaagctc gatcttcgagatgacaagcagttctttgtagatcaccctggtgcagtgccaattaccaca gcgcagggagaggaactaaggaagctgattggggctccggtttacatagaatgcagttca aaaacacagcagaatgtgaaagcagtctttgatgcagccattaaagtggttctccagcca ccaaagcagaagaaaaagaagagaaaggcacagaaggcgtgctccatattgtga

DBGET integrated database retrieval system