Pyrus communis (pear): 137732110 Help Entry 137732110         CDS       T10779                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pcox  Pyrus communis (pear) Pathway pcox04517   IgSF CAM signaling pcox04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137732110  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     137732110  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcox03037]     137732110    04812 Cytoskeleton proteins [BR:pcox04812]     137732110 Cilium and associated proteins [BR:pcox03037]  Motile cilia and associated proteins   Dynein arm    137732110 Cytoskeleton proteins [BR:pcox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137732110 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light AAA_7 AdoHcyase_NAD Motif Other DBs NCBI-GeneID:  137732110 NCBI-ProteinID:  XP_068327503 LinkDB All DBs Position 4:complement(10192735..10195606) Genome browser AA seq 119 aa AA seqDB search MSEDAKRSVAGALSAKPNSDDRKPSSAVTTPTGKRVIIKSADMFQDMQKEAVDFAIGAFE KHSVEKDVAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagacgcaaagagaagcgtcgccggagctctgtcggcgaagcccaattccgac gaccggaaaccctcctcggctgtcaccacgcccacgggcaagcgcgtcatcatcaagagc gccgacatgttccaagatatgcagaaggaggccgtcgacttcgccatcggggcatttgag aagcacagcgtggagaaggacgttgccgagtatataaagaaggagttcgataagaagcat ggtcccacttggcattgcattgttggccgtaattttggttcgtatgtgactcatgaaaca aaccactttgtctacttctacttggatcagaaagcagttttgctatttaagtctggttga

DBGET integrated database retrieval system