Pyrus communis (pear): 137737557 Help Entry 137737557         CDS       T10779                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagocytosis pcox04517   IgSF CAM signaling pcox04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137737557  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137737557   09142 Cell motility    04814 Motor proteins     137737557  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcox03037]     137737557    04812 Cytoskeleton proteins [BR:pcox04812]     137737557 Cilium and associated proteins [BR:pcox03037]  Motile cilia and associated proteins   Dynein arm    137737557 Cytoskeleton proteins [BR:pcox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137737557 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  137737557 NCBI-ProteinID:  XP_068333179 LinkDB All DBs Position 6:19783520..19786133 Genome browser AA seq 119 aa AA seqDB search MSEDAKRSVAGALSAKPNSDDRKPSSAVTTPAGKRVIIKSADMFQDMQKEAVDIAIGAFE KHSVEKDVAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagacgcgaagagaagcgtcgccggagctctgtcggcgaagcctaattctgac gaccggaaaccctcctcggctgtcaccactcccgccggcaagcgcgtcatcatcaagagc gccgacatgtttcaggatatgcagaaggaggccgtcgacatcgccatcggggcatttgag aagcacagcgtggagaaggacgttgcggagtatataaagaaggagttcgataagaagcat ggacccacttggcattgcatcgtcggtcgtaattttggttcgtatgtgactcatgaaaca aaccactttgtctacttctacttggatcagaaagcagttttgctatttaagtctggttga

DBGET integrated database retrieval system