Pyrus communis (pear): 137737557 Help Entry 137737557         CDS       T10779                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pcox  Pyrus communis (pear) Pathway pcox04517   IgSF CAM signaling pcox04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137737557  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     137737557  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcox03037]     137737557    04812 Cytoskeleton proteins [BR:pcox04812]     137737557 Cilium and associated proteins [BR:pcox03037]  Motile cilia and associated proteins   Dynein arm    137737557 Cytoskeleton proteins [BR:pcox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137737557 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  137737557 NCBI-ProteinID:  XP_068333179 LinkDB All DBs Position 6:19783520..19786133 Genome browser AA seq 119 aa AA seqDB search MSEDAKRSVAGALSAKPNSDDRKPSSAVTTPAGKRVIIKSADMFQDMQKEAVDIAIGAFE KHSVEKDVAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagacgcgaagagaagcgtcgccggagctctgtcggcgaagcctaattctgac gaccggaaaccctcctcggctgtcaccactcccgccggcaagcgcgtcatcatcaagagc gccgacatgtttcaggatatgcagaaggaggccgtcgacatcgccatcggggcatttgag aagcacagcgtggagaaggacgttgcggagtatataaagaaggagttcgataagaagcat ggacccacttggcattgcatcgtcggtcgtaattttggttcgtatgtgactcatgaaaca aaccactttgtctacttctacttggatcagaaagcagttttgctatttaagtctggttga

DBGET integrated database retrieval system