Pyrus communis (pear): 137740252 Help Entry 137740252         CDS       T10779                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism pcox  Pyrus communis (pear) Pathway pcox04136   Autophagy - other Brite KEGG Orthology (KO) [BR:pcox00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     137740252  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcox04131]     137740252    04121 Ubiquitin system [BR:pcox04121]     137740252    03029 Mitochondrial biogenesis [BR:pcox03029]     137740252 Membrane trafficking [BR:pcox04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     137740252 Ubiquitin system [BR:pcox04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    137740252 Mitochondrial biogenesis [BR:pcox03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     137740252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  137740252 NCBI-ProteinID:  XP_068336200 LinkDB All DBs Position 7:complement(12009985..12012126) Genome browser AA seq 95 aa AA seqDB search MATTESPGAVKKVVVHLRATGDAPILKQTKFKILGTDKFAKVIEFLRRQLHKETLFVYVN SAFSPNPDELVIDLYNNFGFDGKLVVNYACSMAWG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggctaccacggagtctccgggtgctgttaaaaaagtggttgttcatctgagagctact ggtgatgctcctatactcaagcaaaccaaattcaagattcttggaactgacaagtttgct aaagtgattgagtttctacgaaggcaacttcacaaggagaccttgtttgtatatgtaaac agtgcattctcgccgaacccagatgaattggtgattgatctgtataataatttcggtttt gatggtaaactggtggttaactatgcttgctccatggcatggggctga

DBGET integrated database retrieval system