Pyrus communis (pear): 137742971 Help Entry 137742971         CDS       T10779                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism pcox  Pyrus communis (pear) Pathway pcox03083   Polycomb repressive complex pcox04120   Ubiquitin mediated proteolysis pcox04141   Protein processing in endoplasmic reticulum Brite Membrane trafficking [BR:pcox04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     137742971 Ubiquitin system [BR:pcox04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      137742971    Cul7 complex      137742971 Chromosome and associated proteins [BR:pcox03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      137742971   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      137742971 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  137742971 NCBI-ProteinID:  XP_068338998 LinkDB All DBs Position 8:12684394..12684993 Genome browser AA seq 113 aa AA seqDB search MSSSSKKITLKSSDGESFKVEEAVALESQTIKHMIKDDYADNGMSTLPSPTRRSLRTISR PRIRICGDGQLQASSCSISSGTTTSSDGSCSSNLGHSLDSASKMAAAASAATA NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtcatcgtcgtcgaagaagatcaccctcaagagctcagacggcgagtcgttcaaggtc gaggaggcggtggcactagagtcgcagaccatcaagcacatgatcaaggatgattacgct gacaacggcatgtcgacgctgccaagcccaacgagaagatctctgaggacgatctcaagg cctaggatcagaatttgtggagatgggcagttgcaggcttcttcgtgttcgatttcgagc ggcacaaccacaagtagtgatgggagctgctcttctaatttgggacacagtttggactcg gcctcaaagatggctgctgcagcatctgccgccactgcatga

DBGET integrated database retrieval system