Pyrus communis (pear): 137743879 Help Entry 137743879         CDS       T10779                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagocytosis pcox04517   IgSF CAM signaling pcox04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137743879  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137743879   09142 Cell motility    04814 Motor proteins     137743879  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcox03037]     137743879    04812 Cytoskeleton proteins [BR:pcox04812]     137743879 Cilium and associated proteins [BR:pcox03037]  Motile cilia and associated proteins   Dynein arm    137743879 Cytoskeleton proteins [BR:pcox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137743879 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light PLAT Motif Other DBs NCBI-GeneID:  137743879 NCBI-ProteinID:  XP_068339913 LinkDB All DBs Position 8:complement(6356832..6357785) Genome browser AA seq 111 aa AA seqDB search MLEGKAVIVETDMLQTMQQKALDLASKALDSFDITEATEIGRFIKMEFDRTYGPGWQCIV GTDFGSFVTHCQGCFIYFCMGTLAVLLFRGAAGPEAEAKQPCAAALEPVQA NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgctggagggcaaagcagtcatcgttgagactgacatgcttcaaaccatgcagcagaag gcacttgacttagcttccaaagcccttgattcatttgatatcactgaagccactgagata ggccgcttcattaaaatggagtttgacaggacatatggacctggatggcagtgcattgta ggaacagattttggttcctttgttacacattgccaaggttgtttcatctatttttgcatg ggcacccttgcagttttgctgttcaggggagctgcaggtccagaagctgaggcaaagcag ccgtgtgcagcggccttggagccagtacaagcatga

DBGET integrated database retrieval system