Pyrus communis (pear): 137744086 Help Entry 137744086         CDS       T10779                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism pcox  Pyrus communis (pear) Pathway pcox04145   Phagocytosis pcox04517   IgSF CAM signaling pcox04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcox00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     137744086  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     137744086   09142 Cell motility    04814 Motor proteins     137744086  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcox03037]     137744086    04812 Cytoskeleton proteins [BR:pcox04812]     137744086 Cilium and associated proteins [BR:pcox03037]  Motile cilia and associated proteins   Dynein arm    137744086 Cytoskeleton proteins [BR:pcox04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      137744086 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  137744086 NCBI-ProteinID:  XP_068340050 LinkDB All DBs Position 1:complement(11818775..11820240) Genome browser AA seq 93 aa AA seqDB search MLEGKATIREADMPEKMQMQAMACASQALDLHDVFDCKSIAAHIKKEFDKMYGSGWQCVV GSNFGCFFTHSPGTFIYFALETLNFLVFKAASS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctggaagggaaagctacgataagggaagcagacatgccagaaaagatgcagatgcaa gccatggcttgtgcttctcaagcccttgatctccatgacgtttttgattgcaaatccata gccgcccacatcaagaaggaatttgacaagatgtatgggagtgggtggcagtgtgtggtg ggttctaacttcggttgtttcttcactcattcacctggaactttcatatattttgctctg gagaccctcaatttccttgtcttcaaggctgcctcttcttga

DBGET integrated database retrieval system