Pseudomonas citronellolis: PcP3B5_04640 Help Entry PcP3B5_04640      CDS       T04637                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism pcq  Pseudomonas citronellolis Brite KEGG Orthology (KO) [BR:pcq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcq03036]     PcP3B5_04640 Chromosome and associated proteins [BR:pcq03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PcP3B5_04640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Asd-4 Motif Other DBs NCBI-ProteinID:  AMO73972 UniProt:  A0A127ML11 LinkDB All DBs Position complement(514057..514266) Genome browser AA seq 69 aa AA seqDB search MEDADLQTLIAKFDLLLQRLEQLKAENRLLRANEKSWREERAHLIEKNELARHKVEAMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgacctgcaaacgctgatcgccaaattcgacctcctgctccagcgcctg gaacagctcaaggcggagaaccggctgctgcgggccaacgagaaaagttggcgcgaagag cgcgctcatctgatcgagaagaacgaattggcgcgccacaaggtcgaagcgatgattttg cgcctgaaagccctggagcaggactcatga

DBGET integrated database retrieval system