KEGG   Psychrobacter cryohalolentis: Pcryo_0386
Entry
Pcryo_0386        CDS       T00350                                 
Name
(GenBank) response regulator receiver domain protein (CheY-like)
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr02020  Two-component system
pcr02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pcr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pcryo_0386
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Pcryo_0386
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pcr02022]
    Pcryo_0386
   02035 Bacterial motility proteins [BR:pcr02035]
    Pcryo_0386
Two-component system [BR:pcr02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Pcryo_0386
Bacterial motility proteins [BR:pcr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Pcryo_0386
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: ABE74169
UniProt: Q1QDT4
LinkDB
Position
472744..473106
AA seq 120 aa
MYKLMIVDDSNIIRNRIQRAYDSGQFMLVATATSGVQALEKFNIHRPDVVTMDLTMPQMD
GLECIEKIIAIDPDVRILVVSALSDKSTGIEALSLGASGFLCKPFSEEELVESLYELVQD
NT seq 363 nt   +upstreamnt  +downstreamnt
atgtataaattaatgatcgtcgatgattcaaatatcattcgaaaccgtattcagcgcgct
tatgactcgggtcaattcatgttggttgctacagcaaccagtggggttcaagcgcttgaa
aagttcaatattcatcgtccagatgtggtgaccatggatttgaccatgccgcaaatggac
ggtcttgagtgtattgaaaaaatcattgctatcgaccctgacgttcgtatcttggttgtc
tcagccttgtctgacaaatctactggcattgaagcgttatcattgggcgcgagtgggttc
ttgtgcaagcctttttcagaagaagagctggtagagtctttgtatgagttggtacaagac
taa

DBGET integrated database retrieval system