Psychrobacter cryohalolentis: Pcryo_0517 Help Entry Pcryo_0517        CDS       T00350                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pcr  Psychrobacter cryohalolentis Pathway pcr01100   Metabolic pathways pcr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pcryo_0517    00074 Mycolic acid biosynthesis     Pcryo_0517   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pcryo_0517 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ABE74300 UniProt:  Q1QDF3 LinkDB All DBs Position 612485..612721 Genome browser AA seq 78 aa AA seqDB search MSNDTEQRVKAAVAEQLGMNVEDINNDASFMEDLGADSLDLVELVMSFESDFGITIPDED SAELTTVQKAIDYVQAQL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtaatgataccgagcaaagagttaaagctgccgtagctgagcaactaggtatgaat gttgaagacatcaacaatgatgcttcatttatggaagacttaggcgctgattcactggat ttagttgagttggttatgtcatttgaaagcgattttggcatcacaattcctgacgaagat tcagcagaattaacgactgttcaaaaagcaatcgactacgtacaagcacagctataa

DBGET integrated database retrieval system