Porphyromonas crevioricanis: NCTC12858_00409 Help Entry NCTC12858_00409   CDS       T05510                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pcre  Porphyromonas crevioricanis Pathway pcre01100   Metabolic pathways pcre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC12858_00409 (acpP)    00074 Mycolic acid biosynthesis     NCTC12858_00409 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC12858_00409 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 DUF1409 Motif Other DBs NCBI-ProteinID:  SQH72585 UniProt:  A0A0A2FXV9 LinkDB All DBs Position 1:437612..437845 Genome browser AA seq 77 aa AA seqDB search MSEIEAKVRDIIVEKLNLEPSEVTMEASFTNDLGADSLDTVELIMNFEKEFDMQIPDDDA REIKTVADAVAYIESHK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctgaaattgaagcaaaagtacgcgacatcatcgttgagaagttgaatctggaacct tctgaagtaacaatggaagccagctttaccaacgaccttggtgcagattctttggataca gtagagttgatcatgaacttcgaaaaggaattcgatatgcaaattcccgatgacgacgct cgtgaaatcaagactgtagccgacgctgtggcatacatcgaaagccacaagtaa

DBGET integrated database retrieval system