Pelecanus crispus (Dalmatian pelican): 104025881 Help Entry 104025881         CDS       T08340                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism pcri  Pelecanus crispus (Dalmatian pelican) Pathway pcri04010   MAPK signaling pathway pcri04012   ErbB signaling pathway pcri04068   FoxO signaling pathway pcri04137   Mitophagy - animal pcri04140   Autophagy - animal pcri04150   mTOR signaling pathway pcri04210   Apoptosis pcri04218   Cellular senescence pcri04370   VEGF signaling pathway pcri04371   Apelin signaling pathway pcri04540   Gap junction pcri04625   C-type lectin receptor signaling pathway pcri04810   Regulation of actin cytoskeleton pcri04910   Insulin signaling pathway pcri04912   GnRH signaling pathway pcri04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pcri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104025881    04012 ErbB signaling pathway     104025881    04370 VEGF signaling pathway     104025881    04371 Apelin signaling pathway     104025881    04068 FoxO signaling pathway     104025881    04150 mTOR signaling pathway     104025881  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104025881    04137 Mitophagy - animal     104025881   09143 Cell growth and death    04210 Apoptosis     104025881    04218 Cellular senescence     104025881   09144 Cellular community - eukaryotes    04540 Gap junction     104025881   09142 Cell motility    04810 Regulation of actin cytoskeleton     104025881  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104025881   09152 Endocrine system    04910 Insulin signaling pathway     104025881    04912 GnRH signaling pathway     104025881    04916 Melanogenesis     104025881  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcri04131]     104025881   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcri04147]     104025881    04031 GTP-binding proteins [BR:pcri04031]     104025881 Membrane trafficking [BR:pcri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104025881  Endocytosis   Macropinocytosis    Ras GTPases     104025881 Exosome [BR:pcri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104025881   Exosomal proteins of other body fluids (saliva and urine)    104025881   Exosomal proteins of breast cancer cells    104025881   Exosomal proteins of colorectal cancer cells    104025881 GTP-binding proteins [BR:pcri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104025881 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104025881 NCBI-ProteinID:  XP_009478244 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search QDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLY REQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAF YTLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt caggattcatatagaaagcaggttgttattgatggagagacatgcttgttagacattctg gacactgcgggacaggaagagtatagtgccatgcgtgatcagtacatgagaactggggaa ggattcctgtgtgtttttgctattaacaacagtaaatcgtttgctgatattaacctttac agagaacagatcaagagagtgaaagattcagatgatgtgccaatggtgctagttgggaat aagtgtgatttgcctacaagaacagtagacacaaaacaggctcaagaattagcaaaaagc tatggaatccccttcatagagacatctgctaaaacacgacagggtgtggaagatgctttt tacacactggtgagagagatccggcagtaccggatgaaaaagctcaacagcaatgaagat gggaatcaaggctgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system