Pelecanus crispus (Dalmatian pelican): 104026563 Help Entry 104026563         CDS       T08340                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism pcri  Pelecanus crispus (Dalmatian pelican) Brite KEGG Orthology (KO) [BR:pcri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcri03036]     104026563   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcri04147]     104026563 Chromosome and associated proteins [BR:pcri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104026563 Exosome [BR:pcri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104026563 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  104026563 NCBI-ProteinID:  XP_009485620 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search LKRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ctcaaaaggccgggtactgtggctctccgtgaaatcagacgctatcaaaagtctaccgaa cttctgatccgcaaacttcccttccagcgtctggtgcgtgaaattgctcaggatttcaaa acagatctgcgcttccagagcgctgccatcggtgctttgcaggaggcaagtgaagcctac ttggttggcctgtttgaagataccaacctgtgtgctatccatgccaaacgtgtcacaatc atgccaaaagatatccagctagcacgccgcatacgtggagagcgtgcctaa

DBGET integrated database retrieval system