Pelecanus crispus (Dalmatian pelican): 104032581 Help Entry 104032581         CDS       T08340                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism pcri  Pelecanus crispus (Dalmatian pelican) Pathway pcri03272   Virion - Hepatitis viruses pcri04382   Cornified envelope formation pcri04514   Cell adhesion molecule (CAM) interaction pcri04530   Tight junction Brite KEGG Orthology (KO) [BR:pcri00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104032581 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104032581 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104032581 (CLDN1)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104032581 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcri03037]     104032581 (CLDN1)    04147 Exosome [BR:pcri04147]     104032581 (CLDN1) Cilium and associated proteins [BR:pcri03037]  Other cilia and associated proteins   Stereociliary proteins    104032581 (CLDN1) Exosome [BR:pcri04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104032581 (CLDN1)   Exosomal proteins of colorectal cancer cells    104032581 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Cytochrom_B_C OppC_N DUF1218 DUF981 CD20 DUF7937 HlyIII DUF6479 Motif Other DBs NCBI-GeneID:  104032581 NCBI-ProteinID:  XP_009483249 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MVAAILLGLIAVFVAVTGMKCMKCMEDDQVKKMRMAVFGGVIFIIAGLAALVATSWYGNR VARAFYDPFTPVNTRFEFGSALFIGWAAASLAMLGGAFLCCSCPRRETSYPPTRGYPKNA PSTGKDYV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggtggctgcaatactcctgggcctcatcgctgtatttgttgctgtgactggcatgaaa tgcatgaagtgcatggaagatgaccaggtgaagaagatgcggatggctgtctttggtggg gtgatcttcatcattgccggtttggcagcgctggtggccacgtcatggtatggcaacaga gtggctcgggccttttatgaccctttcacccctgtcaacaccagatttgagtttggatca gctctcttcattggctgggcagctgcttctctggccatgctggggggagccttcctctgt tgctcctgtccacggagagaaacttcatatccacccacccgaggctatccaaaaaatgcc ccctccacagggaaggattatgtataa

DBGET integrated database retrieval system