Pelecanus crispus (Dalmatian pelican): 104032754 Help Entry 104032754         CDS       T08340                                  Name (RefSeq) beta-2-microglobulin-like   KO K08055   beta-2-microglobulin Organism pcri  Pelecanus crispus (Dalmatian pelican) Pathway pcri05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pcri00001]  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     104032754  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcri04147]     104032754 Exosome [BR:pcri04147]  Exosomal proteins   Exosomal proteins of breast milk    104032754 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  C1-set Ig_3 Ig_2 I-set C2-set_2 ig Motif Other DBs NCBI-GeneID:  104032754 NCBI-ProteinID:  XP_009483478 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search APKVDVYSRKHAAYGEENTLNCFVSGFHPPKIDITLLKNGEPMSNVQYTDMSFNDKWYFQ RLVYAPFTPKKGDIYVCRVAHSAFREPQLFRWEEDF NT seq 293 nt NT seq  +upstreamnt  +downstreamnt aggcaccgaaggtggatgtgtactcccgcaaacatgccgcatatggagaggaaaacaccc tcaactgcttcgtgagtggtttccaccctccgaagattgatatcacccttctcaagaacg gggagcccatgagcaacgtgcagtacacggacatgtccttcaatgacaagtggtatttcc agcgcctggtgtatgcaccgttcacccccaagaagggagacatctatgtctgcagggtgg cccattctgccttcagagagccgcagttattccgatgggaggaagacttctaa

DBGET integrated database retrieval system