Pelecanus crispus (Dalmatian pelican): 104033574 Help Entry 104033574         CDS       T08340                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism pcri  Pelecanus crispus (Dalmatian pelican) Pathway pcri04010   MAPK signaling pathway pcri04012   ErbB signaling pathway pcri04068   FoxO signaling pathway pcri04137   Mitophagy - animal pcri04140   Autophagy - animal pcri04144   Endocytosis pcri04150   mTOR signaling pathway pcri04210   Apoptosis pcri04218   Cellular senescence pcri04370   VEGF signaling pathway pcri04371   Apelin signaling pathway pcri04510   Focal adhesion pcri04540   Gap junction pcri04625   C-type lectin receptor signaling pathway pcri04810   Regulation of actin cytoskeleton pcri04910   Insulin signaling pathway pcri04912   GnRH signaling pathway pcri04916   Melanogenesis pcri05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcri00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104033574 (HRAS)    04012 ErbB signaling pathway     104033574 (HRAS)    04370 VEGF signaling pathway     104033574 (HRAS)    04371 Apelin signaling pathway     104033574 (HRAS)    04068 FoxO signaling pathway     104033574 (HRAS)    04150 mTOR signaling pathway     104033574 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104033574 (HRAS)    04140 Autophagy - animal     104033574 (HRAS)    04137 Mitophagy - animal     104033574 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104033574 (HRAS)    04218 Cellular senescence     104033574 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104033574 (HRAS)    04540 Gap junction     104033574 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104033574 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104033574 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104033574 (HRAS)    04912 GnRH signaling pathway     104033574 (HRAS)    04916 Melanogenesis     104033574 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104033574 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcri04131]     104033574 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcri04147]     104033574 (HRAS)    04031 GTP-binding proteins [BR:pcri04031]     104033574 (HRAS) Membrane trafficking [BR:pcri04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104033574 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104033574 (HRAS) Exosome [BR:pcri04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104033574 (HRAS)   Exosomal proteins of colorectal cancer cells    104033574 (HRAS) GTP-binding proteins [BR:pcri04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104033574 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  104033574 NCBI-ProteinID:  XP_009484529 UniProt:  A0A091SX82 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagccggtggtgttgggaagagtgctttgacg atacagctcattcagaaccatttcgttgatgagtatgaccccacgatagaggattcctac agaaagcaagttgtcatcgatggagagacctgcttgttagacatcttggatactgcgggg caagaggagtacagtgccatgagagaccagtacatgagaacaggggaaggattcctttgc gtctttgccatcaacaacaccaagtcctttgaagacattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgatcta ccagcccggacagtggagacccggcaagcgcaggacctggcccggagttacgggatcccc tacatagaaacatctgccaaaaccagacagggtgttgaagatgccttctacaccttggtg cgggaaatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccctggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system