Pelecanus crispus (Dalmatian pelican): 104034622 Help Entry 104034622         CDS       T08340                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism pcri  Pelecanus crispus (Dalmatian pelican) Pathway pcri04060   Cytokine-cytokine receptor interaction pcri04620   Toll-like receptor signaling pathway pcri04621   NOD-like receptor signaling pathway pcri04623   Cytosolic DNA-sensing pathway pcri05164   Influenza A pcri05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pcri00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104034622 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104034622 (CCL5)    04621 NOD-like receptor signaling pathway     104034622 (CCL5)    04623 Cytosolic DNA-sensing pathway     104034622 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104034622 (CCL5)    05168 Herpes simplex virus 1 infection     104034622 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcri04052]     104034622 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:pcri00536]     104034622 (CCL5) Cytokines and neuropeptides [BR:pcri04052]  Cytokines   Chemokines    104034622 (CCL5) Glycosaminoglycan binding proteins [BR:pcri00536]  Heparan sulfate / Heparin   Chemokines    104034622 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104034622 NCBI-ProteinID:  XP_009485942 LinkDB All DBs Position Unknown AA seq 90 aa AA seqDB search MNVSAVCLSITLIAALFSQASPAPIGADTTVCCFSYTLRKLPQSHVKNYFYTSSKCSQPA VVFITTKDWGVCANPDARWVKEYVNTLELQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaatgtctccgcagtgtgcctctccatcaccctcattgctgccctcttttctcaggcc tctcctgctccaattggggctgacacaactgtgtgctgcttcagctacaccttacgaaag ctgccccagagtcatgtgaagaattatttctacaccagcagcaagtgctcacagccagca gttgtgttcatcaccacgaaggactggggggtctgtgctaaccctgatgccaggtgggtg aaggaatatgtgaataccctggagctgcagtga

DBGET integrated database retrieval system